KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_158Help
Entry
BUAP5A_158        CDS       T00820                                 

Gene name
nuoH
Definition
(GenBank) NADH dehydrogenase subunit H
  KO
K00337  NADH-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
bap00190  Oxidative phosphorylation
bap01100  Metabolic pathways
Module
bap_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bap00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BUAP5A_158 (nuoH)
Enzymes [BR:bap01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BUAP5A_158 (nuoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh
Motif
Other DBs
NCBI-ProteinID: ACL30533
UniProt: B8D8W1
Position
172145..173113
Genome map
AA seq 322 aa AA seqDB search
MIWLEENMIKITFCFFKVIFILLLIVFSSAMLSIVERRLLAVFQNRYGPNRVGWMGSLQL
CADMIKILFKEDWIPPFSRKFIFVLSPVIAFTSLLCVIPIIPFTSHFVIIDLNIGILFFL
MMASLSVYAILFAGWSSNNKYALLGAMRACVQTLSYEVFLGLSLMGVVAQSGSFKISDIV
NSQKYIWNVFPQFFGFLTFLIAGLAVCHRHPFDQPESEQELADGYHIEYSGMKFGLFFIG
EYISIITVSSLIVTLFFGGWLGPWIPGCIWFILKIIFFIFLFILIRAALPRPRYDQVLLF
GWKFCLPLTLFNLFLTAFLILV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatttggttagaagagaacatgattaaaataactttttgtttttttaaagttattttt
attttattattaatagtattctctagtgctatgttgagtatagttgaacgaagactatta
gccgtatttcaaaatagatatggccctaatcgagttggttggatggggagtttacaatta
tgcgctgatatgattaaaattttatttaaagaagattggattcctccttttagcagaaaa
tttatttttgttttatcaccagtaatagcttttacctctttactgtgtgttattcctatt
attccttttacatctcattttgttattattgatttaaatatagggattttatttttcttg
atgatggccagtttatctgtttatgcaatattatttgcaggttggtcaagtaataataag
tatgcattattaggagctatgcgtgcatgtgtgcaaacattaagttatgaagtattttta
ggtttatcattaatgggtgtagtcgctcagtcaggatcttttaaaatatctgatattgtc
aatagtcaaaaatatatctggaatgtttttccacagttttttggttttttaacttttctc
atagccggtttagcagtttgtcatagacatccttttgatcaacctgaatctgaacaagaa
ttagctgatggttatcatattgaatattcagggatgaagtttggtttattttttattggc
gaatatatttctattattaccgtttcatcattaatagttacacttttttttggtggttgg
ttaggtccttggattcccggttgtatttggtttattttaaaaattattttttttattttt
ctttttattttaatccgagcagctttgccaagaccacgatatgatcaagtattattattt
ggatggaaattttgtttaccattaacattgtttaatttatttttgactgcttttttaatt
ttggtataa

DBGET integrated database retrieval system