KEGG   Buchnera aphidicola 5A (Acyrthosiphon pisum): BUAP5A_384Help
Entry
BUAP5A_384        CDS       T00820                                 

Gene name
rplM
Definition
(GenBank) 50S ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
bap  Buchnera aphidicola 5A (Acyrthosiphon pisum)
Pathway
bap03010  Ribosome
Module
bap_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bap00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BUAP5A_384 (rplM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bap03011]
    BUAP5A_384 (rplM)
Ribosome [BR:bap03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BUAP5A_384 (rplM)
  Bacteria
    BUAP5A_384 (rplM)
  Archaea
    BUAP5A_384 (rplM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: ACL30745
UniProt: B8D9H4
Position
complement(431311..431739)
Genome map
AA seq 142 aa AA seqDB search
MKTFSIKSSNIKRHWYYVDATNKILGRLASALSFHLRGKHKTEYTPHLDTGDYIIVINAS
KILVTGNKRINKIYYHHTGYVGGIKQSRFEEMISSHPERVIEIAVKGMLPKGALGRSMFK
KLKVFSNENHEHIAQCPQLLNI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttttcaattaaatcaagtaatattaaaagacattggtattatgtagatgcc
acaaataaaatattaggccgattagcaagtgcattatcgtttcatcttagagggaaacat
aagacagaatatactccgcatcttgatactggtgattatatcatcgttataaatgcttct
aaaatattagtcacaggaaataaaaggattaataaaatttattatcatcatacaggttac
gtaggtggtataaaacaatctagatttgaagaaatgatttctagtcatccagaaagagtt
attgaaattgctgtaaaaggtatgcttccaaaaggtgctctaggacgttctatgtttaaa
aagttaaaagttttttctaatgaaaatcatgaacatatagctcagtgtcctcaattattg
aatatttga

DBGET integrated database retrieval system