KEGG   Buchnera aphidicola F009 (Myzus persicae): BUMPF009_CDS00084Help
Entry
BUMPF009_CDS00084 CDS       T03020                                 

Gene name
rplv
Definition
(GenBank) Rplv
  KO
K02890  large subunit ribosomal protein L22
Organism
bapf  Buchnera aphidicola F009 (Myzus persicae)
Pathway
bapf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bapf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BUMPF009_CDS00084 (rplv)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bapf03011]
    BUMPF009_CDS00084 (rplv)
Ribosome [BR:bapf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BUMPF009_CDS00084 (rplv)
  Bacteria
    BUMPF009_CDS00084 (rplv)
  Archaea
    BUMPF009_CDS00084 (rplv)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145 DUF733
Motif
Other DBs
NCBI-ProteinID: AHG61608
Position
complement(560074..560406)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRQARSSAQKIRLIVDLVRGKKVPQALNILTYSNKKAAVLVKKVLESAIANAEH
NDGADIDKLRIKKIFVNEGSTMKRMMPRAKGRADRILKRTSHITVIVSDH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgtcaagcacgttcttctgcacaaaaaatacgtttaatt
gtcgatttagttcgtgggaaaaaagtaccacaagcgttaaatattttaacttatagtaat
aaaaaagcagctgttttagtaaaaaaagtcttagaatcagccattgctaatgcagaacat
aatgatggtgctgatatagataaattaagaattaaaaaaatatttgttaatgaaggttca
acaatgaaaagaatgatgccacgtgctaaaggacgtgcagatcgtattttaaagcgtacg
agtcatattactgtgattgtatctgatcattaa

DBGET integrated database retrieval system