KEGG   Buchnera aphidicola F009 (Myzus persicae): BUMPF009_CDS00144Help
Entry
BUMPF009_CDS00144 CDS       T03020                                 

Gene name
recd
Definition
(GenBank) Recd
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bapf  Buchnera aphidicola F009 (Myzus persicae)
Pathway
bapf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bapf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BUMPF009_CDS00144 (recd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bapf03400]
    BUMPF009_CDS00144 (recd)
Enzymes [BR:bapf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BUMPF009_CDS00144 (recd)
DNA repair and recombination proteins [BR:bapf03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BUMPF009_CDS00144 (recd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_19 AAA_30 AAA_11 UvrD_C_2 Helicase_RecD Viral_helicase1 SH3_13 DUF2075 PhoH AAA_22 RsgA_GTPase T2SSE TrwB_AAD_bind FtsK_SpoIIIE UvrD-helicase SMC_N AAA
Motif
Other DBs
NCBI-ProteinID: AHG61666
Position
503589..505418
Genome map
AA seq 609 aa AA seqDB search
MTSLLKKAVIMKIIRPIDFYFSQFISKKNTILMLVAACVSYENKNGHIFLPIEYFEKNHF
FSTTNTKFIQKILNILEKKINWLEELLQHNSVSNGSDSTPLVLFKKKIYLYKMWKSEINI
LKFLNEKNKNKKVHNKKFSKILDNLFPEKFKNTQKIAVALTLIKNITFIIGGPGTGKTTT
ILKIIIALIKTAKKSIKIQLSAPTGKATTRLNEIIENNIFDIYLSQKEKTYLPCSAITIH
QLLGFQKISQKSFFNKNNRLNLDVLIIDETSMIDILMIEKIFDAVSKNTKLIFIGDHNQL
CPIDAGSILKSIARYSNNGYNYKTLLNLEKLTNYKIANKINENKINSINNNICILKKNYR
FKKNSGIYILSNAISNKKINIFEELFNNSIQNVFFYEINSMENYQKMIENISLNYKKFWE
KIYKKEKIQNIIETFQYHQVLCVLRDGIFGANILNKKIEEEMYKKDMIKYFYINNKIWYV
GKPIMINSNNQLLDVFNGNIGITNMSNKGVLQVSFLKEKNIINIPINILRNYETAWVITV
HKAQGSEFMNTSLILPNVDSNILNKDVLYTGITRSRNILNIFSNKKIFIKTALKNIKKNN
FIEMNNFLE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacttttaaaaaaagctgtgatcatgaaaattattcgtcctattgatttttat
ttttcacaatttatatcaaaaaaaaacactattttaatgttagttgcagcatgtgtgagc
tatgaaaataaaaatggtcatatttttttaccaatagaatattttgaaaaaaatcatttt
ttttctactacaaatacaaaatttatacaaaaaattttaaatatattagaaaaaaaaata
aattggttagaagaattattacaacacaactctgttagtaacggttctgattctacacct
ttagtattatttaaaaaaaaaatatatctttataaaatgtggaaatctgaaataaacatt
ttaaaatttttaaatgaaaaaaataaaaataaaaaagtgcataataaaaaattttctaaa
atattagataatttattccctgaaaaatttaaaaacactcaaaaaatagcggtagcacta
actttaataaaaaatataacttttattattggcggacctggaactggaaaaactactact
atattaaaaataattattgctctaataaaaacagcaaagaaatcaataaaaattcaatta
tctgctcctactggaaaagcaacaacacgtttaaacgaaattatagaaaataatattttt
gatatttatctttctcaaaaagaaaaaacttatcttccatgctctgctataacaatacat
caattattaggatttcaaaaaatatcacaaaaaagttttttcaataaaaacaatcgatta
aatttagacgtattaattattgatgaaacttcaatgatagatattttaatgatagaaaaa
atatttgatgcagtatctaaaaatactaaattaatttttataggagatcataatcaatta
tgtccaatagatgcaggttctattttaaaaagtattgctcgttactctaataacggatac
aactataaaactttattaaatctagaaaaactgacaaactataaaatagcaaataaaata
aatgaaaataaaatcaactctattaataataatatttgtatattaaaaaaaaattataga
tttaaaaaaaattcaggaatttatattttatcaaatgcaatatctaataaaaaaataaat
atttttgaagaactatttaataatagcattcaaaacgtttttttttatgaaataaattct
atggaaaattatcaaaaaatgattgagaatatttctttaaattataaaaagttttgggaa
aaaatatataaaaaagaaaaaattcaaaacatcatagaaacttttcaatatcatcaagta
ttatgtgtattacgcgatggtatcttcggtgcaaatatattaaataaaaaaatagaagaa
gaaatgtataaaaaagacatgatcaaatatttttatattaataataaaatatggtatgta
ggaaaacctattatgattaattctaataatcaacttctagatgtatttaatggcaatata
ggtattactaatatgagtaataagggtgtcttacaagtatcttttttaaaagaaaaaaat
attataaatattcctataaatatcttaagaaattatgaaacagcttgggttattactgta
cataaagcacaaggttctgaatttatgaatacgtctttaatattacctaatgttgattca
aatattttaaataaagatgttttatatactggtatcacaagatctcgaaatatattaaat
attttttcaaacaaaaaaatttttataaaaacagctttgaaaaatataaaaaagaataat
tttatagaaatgaacaactttttagaataa

DBGET integrated database retrieval system