KEGG   Buchnera aphidicola F009 (Myzus persicae): BUMPF009_CDS00148Help
Entry
BUMPF009_CDS00148 CDS       T03020                                 

Gene name
fba
Definition
(GenBank) Fba
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bapf  Buchnera aphidicola F009 (Myzus persicae)
Pathway
bapf00010  Glycolysis / Gluconeogenesis
bapf00030  Pentose phosphate pathway
bapf00051  Fructose and mannose metabolism
bapf00680  Methane metabolism
bapf01100  Metabolic pathways
bapf01110  Biosynthesis of secondary metabolites
bapf01120  Microbial metabolism in diverse environments
bapf01130  Biosynthesis of antibiotics
bapf01200  Carbon metabolism
bapf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bapf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUMPF009_CDS00148 (fba)
   00030 Pentose phosphate pathway
    BUMPF009_CDS00148 (fba)
   00051 Fructose and mannose metabolism
    BUMPF009_CDS00148 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    BUMPF009_CDS00148 (fba)
Enzymes [BR:bapf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BUMPF009_CDS00148 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase Ntox22
Motif
Other DBs
NCBI-ProteinID: AHG61670
Position
494818..495894
Genome map
AA seq 358 aa AA seqDB search
MNILNIIQPGVMTGDEARITFEFAKKKGFAIPAVNCIGTDSINTVLETSARVRSPVIIQF
SHGGAAFIAGYQKKSLMIQEQAIKGAISGAQHVHLMAKYYNVPVILHTDHCTKDMLSWID
GLLEFGEKYYRKNSKPFFTSHMIDLSKENLEENISTCSQYLKRMKKINMLLEIELGCTGG
EEDGVDNTKIDKKLLYTQPQDVNFAYENLKKISENFSIAASFGNIHGVYQPGNVDLQPII
LKNSQKYVSIKHNLGKNPLNLVFHGGSGSHLEEIQESIKYGIVKMNIDTDMQWATWNGVY
NFYKKNKEFLQNQLGNKTDKHKPNKKYYDPRSWIRESQKSMSIRLEQAFKELNAFNIL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattttgaatatcattcaaccaggtgtgatgactggtgatgaagctcgaataaca
tttgaattcgcgaaaaaaaaaggttttgcaataccagctgttaattgtattggaactgat
tctataaatactgtattagaaacgtctgctagagtgcgatctccagttatcatacaattt
tcacatggaggagcagcttttattgcaggttatcaaaaaaaatctttaatgattcaagaa
caagctattaaaggagctatatcaggagctcaacatgtgcatttaatggcaaaatactat
aatgtaccagtaatacttcatacagaccattgtacaaaagacatgttgtcatggattgat
ggattactagaattcggagaaaaatactatagaaaaaatagtaaacctttttttacttct
catatgattgatctatcaaaagaaaatttagaagagaacatatcaacttgcagtcaatat
ctcaaaagaatgaaaaaaattaatatgctgttagagatagaactaggatgtacaggaggt
gaagaagatggtgttgacaatactaaaatagataaaaaattactttatacacaacctcaa
gatgttaatttcgcatatgaaaatcttaaaaaaataagcgaaaattttagtattgcagct
tcatttggtaatatacatggtgtttaccaaccaggaaacgttgatcttcaacctattatt
ttaaaaaattcacaaaaatatgtcagtattaaacacaatttaggaaaaaatccattaaat
ctagtatttcatggaggttcaggttcacatttagaggaaatacaagaatctattaaatat
ggtattgtaaaaatgaatattgatactgatatgcaatgggcaacatggaacggagtttac
aatttttataaaaaaaacaaagaatttttacaaaatcaattaggaaataaaacagataaa
cataaacctaataaaaaatactatgatccaagatcatggataagagaatctcaaaaatca
atgtctattagattagaacaagcatttaaggaattaaacgcttttaacatcttataa

DBGET integrated database retrieval system