KEGG   Buchnera aphidicola G002 (Myzus persicae): BUMPG002_CDS00084Help
Entry
BUMPG002_CDS00084 CDS       T03021                                 

Gene name
rplv
Definition
(GenBank) Rplv
  KO
K02890  large subunit ribosomal protein L22
Organism
bapg  Buchnera aphidicola G002 (Myzus persicae)
Pathway
bapg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bapg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BUMPG002_CDS00084 (rplv)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bapg03011]
    BUMPG002_CDS00084 (rplv)
Ribosome [BR:bapg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BUMPG002_CDS00084 (rplv)
  Bacteria
    BUMPG002_CDS00084 (rplv)
  Archaea
    BUMPG002_CDS00084 (rplv)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145 DUF733
Motif
Other DBs
NCBI-ProteinID: AHG61036
Position
complement(560083..560415)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRQARSSAQKIRLIVDLVRGKKVPQALNILTYSNKKAAVLVKKVLESAIANAEH
NDGADIDKLRIKKIFVNEGSTMKRMMPRAKGRADRILKRTSHITVIVSDH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgtcaagcacgttcttctgcacaaaaaatacgtttaatt
gtcgatttagttcgtgggaaaaaagtaccacaagcgttaaatattttaacttatagtaat
aaaaaagcagctgttttagtaaaaaaagtcttagaatcagccattgctaatgcagaacat
aatgatggtgctgatatagataaattaagaattaaaaaaatatttgttaatgaaggttca
acaatgaaaagaatgatgccacgtgctaaaggacgtgcagatcgtattttaaagcgtacg
agtcatattactgtgattgtatctgatcattaa

DBGET integrated database retrieval system