KEGG   Buchnera aphidicola (Aphis glycines): IX46_02945Help
Entry
IX46_02945        CDS       T04764                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
baph  Buchnera aphidicola (Aphis glycines)
Pathway
baph00051  Fructose and mannose metabolism
baph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    IX46_02945
Enzymes [BR:baph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     IX46_02945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Salt_tol_Pase
Motif
Other DBs
NCBI-ProteinID: ALD15492
UniProt: A0A0M4HVS5
Position
complement(592476..593651)
Genome map
AA seq 391 aa AA seqDB search
MNVLHIGAGNIGRGFIGKSIFQSGFHLTFTDINQNIIDALNHYKKYTVKLVGYNYEEIIS
INNFHAIHLKHPNLLNIISDANLITTAVGASSLDNIAIILAQGILLKIKLKSKIPLNIIA
CENKTQASSHLKSIIFKKISIKYHTYLNKYVGFVDCSIDTIIPSTFSFEKNILSLIAEDF
QEWIVCKKQFKGIIPKIINMTVSDDLQSFIDRKILTLNTGHVITAYLGWMRKYKTIYESI
QDNDIQKIVKGAMKESGLALIKKYSFNRNSHFSYIDKILIRFQNPFLLDKIERIARNPLQ
KLRQDERLIKPFLLAKQYNFLYDNLIKGIVSALYYRNKNDVESIQISNLIRNYGIKKTLS
QISNLKVDSPEMNLIAAEYVVMHDFFLKRVI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttacatattggagctggtaacattggtcggggatttattggtaaatcaata
tttcagtctggttttcatcttacatttactgatattaatcagaatataatagacgcacta
aatcattataaaaaatatacagttaaattagttggatataattacgaagaaataattagc
attaataattttcatgcaattcatttaaaacatcctaatttattgaatattatatctgat
gcgaatttaattacaactgctgttggagcatcttctctcgataatattgcaattatttta
gctcaaggaattcttctaaaaattaagttaaaatctaaaattccattaaacattattgct
tgcgaaaataaaactcaagcgagctctcatttaaaatcgattatttttaaaaaaatttct
atcaaatatcatacatatttaaataaatacgtcggctttgttgactgcagtattgatacg
attataccatcaacattttcttttgaaaaaaatatcttatctttaatcgctgaagatttt
caagaatggattgtttgtaaaaagcaatttaaaggcattatacctaaaattattaacatg
acagttagtgatgatttacaatcttttatagatagaaaaatattaacattgaatacagga
catgttataacagcatatttaggttggatgagaaaatataaaactatatacgaaagcatt
caagataatgatatacaaaaaattgtaaaaggcgcaatgaaagaaagtgggttagcgtta
attaaaaaatatagcttcaatagaaacagtcatttttcttatattgataaaattttaatt
cgtttccaaaatccttttttattagataaaattgaacgtattgctagaaatccgttacaa
aaattacgacaagatgaacgtttaataaaaccttttttattagcaaaacaatacaatttt
ttatatgataatctaatcaaaggtattgtatcggctttatattatagaaataaaaatgat
gtagaatcaattcaaattagtaatttaataagaaattatggaataaaaaaaacattaagt
caaatttctaatttaaaagtagatagcccagaaatgaatttgattgctgctgaatatgtt
gtaatgcatgatttctttttgaaaagagttatataa

DBGET integrated database retrieval system