KEGG   Bartonella apis: BBC0122_003230Help
Entry
BBC0122_003230    CDS       T05086                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bapi  Bartonella apis
Pathway
bapi00270  Cysteine and methionine metabolism
bapi00480  Glutathione metabolism
bapi01100  Metabolic pathways
Module
bapi_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bapi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBC0122_003230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBC0122_003230
Enzymes [BR:bapi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BBC0122_003230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AQT46459
UniProt: A0A1U9MFH5
Position
367922..368860
Genome map
AA seq 312 aa AA seqDB search
MKIAIQMDHISTIHMKGDTTFALALEAQRRGHELFHYTPDRLSMLNGEVTARIEALKVRD
EENNYYELGEAKRTPLQQMDVVLLRQDPPFDMNYITTTHILERIMDKTLVVNDPNWVRNS
PEKLFVTEFPDLMPETLITRDVEEVNDFRSEFGDIIIKPLYGNGGAGVFLLKKDDKNLGS
LLEMFNKLYPEAFVVQRYLKDVSAGDKRIILIDGVAVGAINRVAASTDARSNMHIGGRAE
KTELTRRDLEICERIGPSLKKRGLLLVGIDVIGDYMTEINVTSPTGIRELKRFGGADAAK
IFWNHVENKIKG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctatccagatggatcatatctcgaccatccatatgaagggagatacaaca
tttgctctggcattggaggcgcaaaggcggggacacgaactgttccattatacacccgac
cggctttccatgttgaatggagaggtgaccgcccgtatcgaagcattaaaagtgcgggac
gaggaaaacaattattacgaattgggtgaggcaaagcgcacaccgcttcaacaaatggat
gttgttttgctcaggcaggatccaccattcgatatgaattatattacgaccacgcatatt
cttgaacggataatggataagactttggtcgtgaatgatccaaattgggtacgcaatagc
cctgaaaaactctttgttaccgaatttcccgacctgatgccggagacgctcattacccgt
gatgttgaagaggtcaatgattttcgctccgaattcggcgatattattatcaagccactt
tatggaaatggcggggcaggggttttcctgttgaaaaaggacgacaagaatctcggctcg
ctccttgaaatgttcaacaaactttatcctgaagcttttgtcgtgcaacgttatctgaaa
gatgtgagtgccggtgacaagcgcatcatattgattgacggtgtggcggtgggagccatc
aatcgcgttgccgcctcgaccgatgcccgttccaatatgcatattggtggccgtgcagag
aaaacggaattaacccgccgcgaccttgaaatttgcgaacggattggcccgtcattgaaa
aaacgcggtcttcttctcgtcggaatcgatgtcattggcgattatatgacggaaatcaac
gtcacttcgccaaccggcatccgcgaactgaaacgttttggtggtgccgatgctgcaaaa
attttctggaatcatgtggaaaacaaaataaaaggttga

DBGET integrated database retrieval system