KEGG   Bartonella apis: BBC0122_016350Help
Entry
BBC0122_016350    CDS       T05086                                 

Definition
(GenBank) two-component system, OmpR family, phosphate regulon response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bapi  Bartonella apis
Pathway
bapi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bapi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBC0122_016350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bapi02022]
    BBC0122_016350
Two-component system [BR:bapi02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BBC0122_016350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AQT47737
UniProt: A0A1U9MIG1
Position
1902083..1902787
Genome map
AA seq 234 aa AA seqDB search
MTEKNTKLSDDAPHLLVIDDDTRIRSLLSQYLAQNGFRVSVAASADEARRKLAGLDFDLL
IVDVMMPGENGISLTRSLRETKTVPILMLTALSETDSRIDGLEAGADDYLPKPFDPRELL
LRVNAILRRGSTGGQPKIEQLVFGPYTFSIAKKELKKSGEIIKLTDREQEIMVIFAEHAG
TTIPRHKLATGEGEVGERTIDVQINRLRRKIENDPANPVYLQTVRGIGYKLSIE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaaacacaaagctttctgatgatgctccccatcttctggtgatagacgac
gacacacgcatacgtagcctgttgtcgcaatatcttgcccagaacggttttcgtgtttcg
gttgcagccagtgccgatgaagcacggcgtaaattggccggacttgatttcgacctgctg
attgtcgatgtgatgatgccgggggaaaacggcatttcgctcacccgttcgctgcgcgag
acaaaaaccgttccgatattgatgctgacagccttgtcggaaaccgacagtcgcattgac
ggccttgaggcgggagccgatgattatttgcccaagccttttgacccgcgcgagcttttg
ttgcgggtgaacgcgattttgcgtcgcggcagtaccggcggccaaccgaagatagaacaa
ttggtattcggcccctatacattttcgattgccaaaaaagaactgaagaaatcgggcgaa
attataaaactgaccgatcgcgagcaggaaattatggttatttttgccgaacatgcagga
acgacaattccgcgccataaacttgcaacaggtgaaggggaagtgggcgagcgcacgatt
gatgtgcagatcaaccgcttgcgccgcaagatagaaaatgatccggccaatccggtttac
ctgcagacggtgcgcggcatcggctacaagctctcgatcgaatag

DBGET integrated database retrieval system