KEGG   Buchnera aphidicola USDA (Myzus persicae): BUMPUSDA_CDS00272Help
Entry
BUMPUSDA_CDS00272 CDS       T03022                                 

Gene name
zwf
Definition
(GenBank) Zwf
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bapu  Buchnera aphidicola USDA (Myzus persicae)
Pathway
bapu00030  Pentose phosphate pathway
bapu00480  Glutathione metabolism
bapu01100  Metabolic pathways
bapu01110  Biosynthesis of secondary metabolites
bapu01120  Microbial metabolism in diverse environments
bapu01200  Carbon metabolism
Module
bapu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bapu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bapu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BUMPUSDA_CDS00272 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BUMPUSDA_CDS00272 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bapu04147]
    BUMPUSDA_CDS00272 (zwf)
Enzymes [BR:bapu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BUMPUSDA_CDS00272 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BUMPUSDA_CDS00272 (zwf)
Exosome [BR:bapu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BUMPUSDA_CDS00272 (zwf)
  Exosomal proteins of colorectal cancer cells
   BUMPUSDA_CDS00272 (zwf)
  Exosomal proteins of bladder cancer cells
   BUMPUSDA_CDS00272 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N HetR_C
Motif
Other DBs
NCBI-ProteinID: AHG60063
UniProt: W0P4R4
Position
358145..359620
Genome map
AA seq 491 aa AA seqDB search
MIIEINQACDLVIFGTKGDLAKRKLLPALYKLEKSKKIHDNTRIIGAGRADWNRLEYKKI
VKTAIQTFLNEKFDNFIWEKFSTRLYFCNIDVYETLHFFRLKEILQKQKNINIFYCAVPP
NTLNSIFKGLGDTSLNSEPARIVLEKPLGICLKTSKLINDQISKYFLESQIFRIDHYLGK
ESVLNLLALRFANSFFFQNWDNQTIDHIQITVSEEVGIEDRWNYFDKMGQMRDMVQNHLL
QILTIIAMDQPKNLTSEDIREKKLNILGALKRIDINNINMKTVRGQYCAGIIKGKKVFSY
IEESGSNKSSQTETFVAIKVEINNKKWFGVPFYLRTGKRLSHKYSEIVVVFKKNPINLFK
NSHLKLSHNKLIIRLEPNPNIKIDIFNKIPGLKQEYELESSQLEYNHIYQKNYKNSIDAY
ERLLLESMRGIQSLFVSREEVEEAWKWIDPIINAWKEKNKNILQLYISGTWGPKNSDLLL
TREGRFWHKFQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatcatagaaataaatcaagcttgtgatttagtaatttttggcacaaaaggagatctg
gcaaaaagaaaactcttacctgctttatataaattagaaaaatctaaaaaaattcatgac
aatacgcgcataattggtgcaggtcgcgctgattggaatagactagaatataaaaaaata
gtaaaaacagcaatacaaacttttttaaatgaaaaatttgataatttcatttgggagaaa
tttagtactcgtttatatttttgtaatattgatgtttatgaaacattacatttttttaga
ttgaaagaaatattacaaaaacagaaaaatataaatattttttattgtgctgtacctcca
aatacattaaattctatttttaaaggattaggcgatactagtttaaattctgaaccagca
cgaatagttctagaaaaaccattaggtatttgtttgaaaacatctaaactaattaatgat
caaatttctaaatattttttagaatcacaaatttttagaattgaccattatcttggtaaa
gaatcagtactaaatcttcttgctttacgttttgcaaattcattttttttccagaattgg
gataatcaaaccattgatcacattcaaattactgtatctgaagaagtcggtattgaagat
agatggaattattttgataaaatgggacaaatgagagatatggtacaaaaccatctttta
caaatacttactattattgcaatggatcaacctaaaaacttgacatccgaagatatccga
gaaaaaaaattaaatattctaggtgcactaaagcgaatcgatattaataatatcaacatg
aaaactgtacgaggacaatattgtgctggaataataaagggaaaaaaagtattttcttat
atagaagaatctggttcaaataaaagcagtcaaactgaaacatttgttgctattaaagta
gaaattaataataagaaatggtttggtgtaccattttatttaagaacaggaaaacgttta
tcacataaatattctgaaatagtagttgtatttaaaaaaaatcctataaatttatttaaa
aattcacatttaaaattatcacacaataaattaataatacgtttagaacctaatcctaat
attaaaatagacatttttaataaaataccaggattaaaacaagaatatgaattagaaagt
tctcaattagaatataatcatatttatcaaaaaaactataaaaattcaattgatgcctat
gaaagattattattagaaagtatgagaggtattcaatctttatttgtatctcgtgaagaa
gtagaagaagcatggaaatggatagatccaattatcaatgcatggaaagaaaaaaataaa
aatattcttcaattatatatatctggaacttggggaccaaaaaattcagatttattactg
actcgtgaaggtcgtttttggcataaatttcaatag

DBGET integrated database retrieval system