KEGG   Buchnera aphidicola W106 (Myzus persicae): BUMPW106_CDS00486Help
Entry
BUMPW106_CDS00486 CDS       T03023                                 

Gene name
metg
Definition
(GenBank) Metg
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bapw  Buchnera aphidicola W106 (Myzus persicae)
Pathway
bapw00450  Selenocompound metabolism
bapw00970  Aminoacyl-tRNA biosynthesis
bapw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bapw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BUMPW106_CDS00486 (metg)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BUMPW106_CDS00486 (metg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bapw01007]
    BUMPW106_CDS00486 (metg)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bapw03016]
    BUMPW106_CDS00486 (metg)
Enzymes [BR:bapw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BUMPW106_CDS00486 (metg)
Amino acid related enzymes [BR:bapw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BUMPW106_CDS00486 (metg)
Transfer RNA biogenesis [BR:bapw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BUMPW106_CDS00486 (metg)
 Prokaryotic type
   Other AARSs
    BUMPW106_CDS00486 (metg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AHG60838
Position
114010..115656
Genome map
AA seq 548 aa AA seqDB search
MLSTVLRKILVTCALPYANGPIHIGHMLEHIQADIWVRYQRMRGHEVWFVSADDAHGTAI
MLKSENLGISSNQLIKNIRREHQRDFINFKISYDNYYSTHSIENLYLLRKIFSSLNTNGL
IQKKIISQFYDNIKNIFLPDRFIKGTCPLCKSRDQYGDNCEICSSTYDPIDLINPISVIS
GTKPILKDTEHLYFNLPLLSDFLKKWIHSGVLENSVIKKTKEWFQKGLKPWGISRDAPYF
GFKIPGFPNKYFYVWLDAPIGYISAFKNLCLKNKKLNFNSLWHKKSNYELYHFIGKDIIY
FHTLFWPAILEAVYLRKPNGIFVHGYLTMNGLKLSKSRGMLITANDWLKCFDSDSLRYYY
ASKLSNNINDIEMDLEHFITKINSDIVNKLVNLASRNAYFINKYFNGYLSNELSDDKLYQ
YFINSSSKIEDCFENREFSTVIRESMRLIDIANQYINEKKPWKIEVKEENMNKLQKICTM
GINLFRIVMIFLKPILPDLANKTELFLISNLVWQSIKKPLLSHKINKFKPLYTRISFEKI
SQLMNLYR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtactgtattaagaaaaattttagtaacttgtgctttgccttatgcaaatggt
cctattcatattggtcatatgcttgagcatattcaggcagatatttgggttcgttatcaa
agaatgcgagggcatgaagtttggttcgtttctgcagatgacgcacacggtactgctatc
atgttaaaatctgaaaatttagggatatcttcgaatcaactaattaaaaatattagaaga
gaacatcaaagagattttattaatttcaaaatttcttatgataattattattctacacat
agtatagaaaacttatatctactaagaaaaatattttcatctttaaatactaacggttta
attcaaaaaaaaattatttctcaattttatgataatataaaaaatatttttcttcctgat
agatttataaaaggtacgtgtccactttgtaaatcacgagatcaatatggcgataattgt
gaaatatgtagttcaacttatgatcctatagatttaattaatccaatatctgtgatctca
ggaactaaacctattttaaaagatacagaacatttatattttaatttacctcttttaagt
gattttttaaaaaaatggatacattctggtgtattagaaaattcagttattaaaaaaaca
aaggaatggtttcaaaaaggtttaaaaccatgggggatttctagagatgcaccatatttt
ggatttaagattcctggttttcctaataaatatttttatgtatggttagatgcacctatt
ggttatataagtgcttttaaaaatctttgtcttaagaataaaaaattaaattttaatagt
ctttggcataaaaaatctaattatgaattatatcattttatcggaaaagatattatatac
tttcatactttattttggcctgcgatactagaagctgtttatttaagaaaaccgaacggt
atatttgttcatggctatcttacaatgaacggattaaaattatcaaaatcacgtggaatg
ttaattacagctaatgattggttgaaatgctttgattcggatagtttgcgttattattat
gctagtaaattatctaataatattaatgatattgaaatggatttagaacattttatcact
aaaataaatagtgatattgtaaataaactcgtaaatttagcttcaagaaatgcttatttt
attaataaatattttaatggatatttatctaatgaattaagtgacgataaattatatcaa
tattttattaatagtagtagtaaaattgaagattgcttcgaaaaccgtgaatttagtact
gttatcagagaatctatgagattaatagatatagctaatcaatatattaatgagaaaaaa
ccatggaaaattgaagttaaagaagaaaatatgaataaattacaaaaaatttgtactatg
ggtattaatttatttagaatagttatgatttttttaaaaccaatattacctgatttagca
aataaaacagaactatttttaatttctaatttggtttggcaaagtataaaaaaaccatta
ttatctcataaaataaataaattcaaaccattatatacacgtattagttttgaaaaaatt
tctcaattaatgaatctatacagataa

DBGET integrated database retrieval system