KEGG   Bacillus velezensis CAU B946: BACAU_0140Help
Entry
BACAU_0140        CDS       T01692                                 

Gene name
rpmJ
Definition
(GenBank) 50S ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq03010  Ribosome
Module
baq_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:baq00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BACAU_0140 (rpmJ)
Ribosome [BR:baq03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BACAU_0140 (rpmJ)
  Bacteria
    BACAU_0140 (rpmJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L36
Motif
Other DBs
NCBI-ProteinID: CCF03674
Position
148811..148924
Genome map
AA seq 37 aa AA seqDB search
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagaccatcagttaaaccaatctgcgagaaatgtaaagttattcgcagaaaa
ggaaaagtaatggtgatctgtgaaaatccaaagcataaacaaaaacaaggataa

DBGET integrated database retrieval system