KEGG   Bacillus velezensis CAU B946: BACAU_0907Help
Entry
BACAU_0907        CDS       T01692                                 

Gene name
yhcT
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
baq  Bacillus velezensis CAU B946
Brite
KEGG Orthology (KO) [BR:baq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:baq03009]
    BACAU_0907 (yhcT)
Enzymes [BR:baq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BACAU_0907 (yhcT)
Ribosome biogenesis [BR:baq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BACAU_0907 (yhcT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CCF04441
Position
complement(968820..969728)
Genome map
AA seq 302 aa AA seqDB search
MKQNDRGLELLITEKHAGKWLFSVLKSEFQASKPVITEWMNQKSIQVNRTSPKNNIILKT
GDRLFIDLQEKTGSSVIPEYGEPDILFEDSHMLIANKPAGMPTHPNEEGQTGTLSNLIAY
HFQINGEQAKVRHVHRLDRDTSGAVVFAKHRLAHAILDRQLETKTLKRTYIAAAEGKVTP
KKGTVDSPIGRDKSHSVRRRVSPGGQAAVTHYKVKGYHPGAQLTLAELELETGRTHQIRV
HMASIGHPLAGDDLYGGSRALFHRQALHAKKVSVVHPISGEEIVAEAPMPADLAHFTETY
FS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatgaccgcggtctggaactcctgattacggaaaaacacgccggaaaatgg
ctgttttcagtcctgaaatctgaattccaggcgtcaaaacccgtgataacggaatggatg
aaccaaaaaagcattcaggtgaatcggacatccccgaaaaacaacatcatactgaaaacc
ggagaccgcttattcattgatcttcaggaaaaaacgggttcttcggtaattcctgaatac
ggagagccggacattttatttgaggacagtcatatgctgattgcaaataagccggcggga
atgccgactcatccaaatgaagagggtcagaccggaaccctcagcaacctgatcgcttac
cattttcaaatcaacggcgaacaggcgaaagtgcgccacgttcaccgtcttgaccgtgac
acgtcaggcgcggtcgttttcgcgaaacaccgcctggcccatgcaatccttgaccgtcag
ctcgaaaccaaaacattaaaacgcacctatatcgccgcggcggaaggaaaagtcacgccg
aaaaaaggcacggttgactcgccgatcggccgcgacaagtcacattccgtcagacggcgc
gtctcacccggcggacaagccgccgtcacccattacaaagtgaaaggctatcatcccggt
gcgcagcttacattggcagagcttgaactggaaaccgggagaacacatcaaatcagggtg
catatggcaagcatcggccatccgttggcgggcgatgacctgtacggcggaagcagggcg
ctgtttcacaggcaggcgcttcacgccaaaaaagtcagtgtcgtccatccgatctcagga
gaagaaatcgttgccgaggcgccgatgccggctgatcttgctcattttaccgaaacgtat
ttttcttaa

DBGET integrated database retrieval system