KEGG   Bacillus velezensis CAU B946: BACAU_1563Help
Entry
BACAU_1563        CDS       T01692                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00020  Citrate cycle (TCA cycle)
baq00640  Propanoate metabolism
baq00660  C5-Branched dibasic acid metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
Module
baq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BACAU_1563 (sucC)
   00640 Propanoate metabolism
    BACAU_1563 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BACAU_1563 (sucC)
Enzymes [BR:baq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BACAU_1563 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CCF05097
Position
1647861..1649018
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESLSSSVYVVKAQIHAGGRGKAGGV
KIAKTKDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LNESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatacggggtgtctgttcct
gaaggtaaagtggcttttacagcagaggaagcagttgaaaaagcagagagcctgtcaagc
tcggtttatgtcgtaaaggcgcaaatccatgctggcggccgcggcaaagctggtggggta
aagattgcaaaaacaaaagatgaagtgaaagagtatgccgaagaactgttaggcaagacg
ctcgtcacacatcaaacgggtccggacggacaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaggaatactatgtcgggcttgtacttgaccgcgctacttcaaga
atcgttttaatggcgtctgaagaaggcggaacggagattgaagaagtagcggaaaaaaca
cctgaaaaaattaaaaaagcggtaattgatccggctgtcggccttcagggctaccaggca
agggaaattgcattcgcaattaacatcccgaaagagcttgtcggcaaagccgctaaattt
atgctcggtttatataaagcatttgttgagaaggactgctccatcgctgagatcaaccct
ctcgtcgttacgggggacggaaacgtcatggcgctggatgctaagctgaacttcgacagc
aatgcgttatacagacaaaaagacattatggaatacagagatttagatgaagaagatccg
aaagaaatcgaagcgtcaaaatacgatttaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggtcttgcaatgtctacaatggatatcattaaacactacggc
ggagaacctgcaaacttccttgatgtcgggggcggcgcaaccgcagaaaaagtgacggaa
gcttttaaaatcattctttccgatcaaaacgtaaaaggaattttcgttaatattttcgga
ggcatcatgaagtgtgatgtcatcgccgagggcgttgttgaagcgacgagacaagtcgga
ttgacattgccgctggtcgtgcgccttgaagggacaaacgtagatttaggaaagaaaatc
ctgaatgaatcaggcttaaacatcacatctgcggaatcaatggcagacggcgcacagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system