KEGG   Bacillus velezensis CAU B946: BACAU_1610Help
Entry
BACAU_1610        CDS       T01692                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00900  Terpenoid backbone biosynthesis
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01130  Biosynthesis of antibiotics
Module
baq_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BACAU_1610 (dxr)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BACAU_1610 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCF05144
Position
1690080..1691231
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRMHQDQFRLVSMTFGKNAEKAIPLIRTFQPKYVAVGDMD
TYQKVKEASFSHECQIGIGEEGLIEAAVMDEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKGHAKRYGVPLLPVDSEHSAIFQALQGEQSKNIERLIITASGGSFRD
KTRQELESVTIADALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDRSVIAQLGNPDMRVPIQYALTYPDRLPLPETKRLELWEIGSLHFAKAD
FERFRCLQFAFESGKIGGTMPTVLNAANEEAVAAFLAGRISFLSIEDLIEKALDRHSVIQ
DPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatatttgtcttttaggagcaacaggatcaatcggggagcagacgttagacgta
ttgcgcatgcatcaagatcagttccgtctcgtctcgatgactttcggtaaaaacgccgag
aaagcgatcccgttgatcagaacgtttcagccgaaatatgtagcagtcggcgacatggat
acatatcaaaaagtgaaagaagcgtctttttcgcatgaatgtcaaatcggcatcggagaa
gaaggcctgattgaagcggcagtcatggacgaagtggatatcgtggtcaatgcgctgctt
ggaagcgtcggtttaatcccgactttgaaagcgattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactctcgtcactgccgggcatatagtgaaaggacacgcaaaacgatac
ggtgttcctcttcttccggttgacagcgaacattccgctatttttcaggcgctgcaaggc
gaacagagcaaaaatatcgagcgcctgatcattacggcatccggcggcagtttcagggat
aaaacgcggcaggagcttgagtctgtaacgattgccgacgcccttaatcacccgaactgg
tcgatgggtgcaaagattacgattgactcggctacaatgatgaataaagggcttgaagtc
attgaagcgcattggctgtttgacattccgtatgaacagattgacgttgtattacataaa
gagagcatcattcattcgatggttgaatttcacgacagaagcgtcatcgcccagctcgga
aatccggacatgagggtgccgattcaatacgcgctgacatatccggaccggctgcctctg
cctgaaacaaaaaggcttgaattatgggagatcggaagccttcattttgctaaagctgac
tttgaaaggttccgctgcttacaatttgcctttgaatcaggtaaaatagggggaacgatg
ccgacggttttaaatgcggccaacgaagaagccgttgccgcttttcttgccggacggatt
tcattcttatcgattgaggacctgattgaaaaagcattggaccgccacagcgtaattcag
gatccgagtcttgcggatatccaagaagtggacaaagacacccggggatacgttaattca
atactcacataa

DBGET integrated database retrieval system