KEGG   Bacillus velezensis CAU B946: BACAU_1710Help
Entry
BACAU_1710        CDS       T01692                                 

Gene name
adh1
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00071  Fatty acid degradation
baq00350  Tyrosine metabolism
baq00625  Chloroalkane and chloroalkene degradation
baq00626  Naphthalene degradation
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_1710 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    BACAU_1710 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BACAU_1710 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BACAU_1710 (adh1)
   00626 Naphthalene degradation
    BACAU_1710 (adh1)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BACAU_1710 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CdhD 2-Hacid_dh_C GFO_IDH_MocA Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CCF05244
Position
complement(1861915..1862931)
Genome map
AA seq 338 aa AA seqDB search
MKAVVATKDKSIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEVGEGVTSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAIKVPENLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVAKAKEVTNDSGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFQFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtagcaacaaaagacaaaagtatagcgatcgtacaaaaagaattacgt
cctttgcggcatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgttaccggcgtcactttaggtcatgaggga
ataggcattgtgactgaggttggtgaaggcgtaacaagcctgaaaaagggcgaccgcgtc
tctattgcctggatgtttgaaagctgcggccgctgcgaatattgcttaacaggccgtgaa
accttgtgccgggatgtaaaaaatgccggctatacagttgacggcgcaatggctgaagaa
gcaatcgtagcggttgattacgcaataaaggtgccggaaaatttagatcctgcagcagca
agcagcattacttgtgcaggtgtaacaacttataaagcggttaaagtcagtgaaattaaa
ccaggtcaatggatcggtgtatttggagtcggcggtttaggcaacttggctgttcaatat
gcaaaaaacgtctttaacgctaaagtgattgctttcgacattagcgatgaaaaattgaat
tttgctaagagcttaggcgctgatgcggttgtaaacagtttaaacgaagaccccgtcgct
aaggcaaaagaagtgactaacgattcagggcttgatgctgcggtcatcacggctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagctcgcgtagtcgccgtc
ggtttaccggtggacaaaatggatttagatattccccgtctcgtgttagatggaattcag
gtagtaggttcattagtgggtaccagagaagacctgaaggaagcttttcaatttgctgca
gacggtaaagttgtacctaaagttacaaaacgcccgattgaagatgtgaatgatattttt
gaagaaatggagcaaggcaaagtgaccggccgcatggttatcgattttacttcctaa

DBGET integrated database retrieval system