KEGG   Bacillus velezensis CAU B946: BACAU_1778Help
Entry
BACAU_1778        CDS       T01692                                 

Gene name
scoB
Definition
(GenBank) 3-oxoacid CoA-transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00072  Synthesis and degradation of ketone bodies
baq00280  Valine, leucine and isoleucine degradation
baq00650  Butanoate metabolism
baq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BACAU_1778 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BACAU_1778 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BACAU_1778 (scoB)
Enzymes [BR:baq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BACAU_1778 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CCF05312
Position
complement(1958806..1959468)
Genome map
AA seq 220 aa AA seqDB search
MRDSRKRMIKRAVKEIKDGMNVNLGIGMPTLVANEIPNDYNVLLQSENGLLGIGPYPAEG
TEDPDLINAGKETITEVKGASYFDSAESFAMIRGGHIDVAILGGMEVSERGDLANWMIPG
KMIKGMGGAMDLVHGAKRIIVIMEHVNKYGESKVRTECTLPLTGRQVVDRLITDLAVFDF
HDGRMTLTELQEGVTIEEVFEKTEGHFTVSQSLKNGVRPK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagagatagcagaaaacgaatgatcaaacgggctgtaaaggaaattaaggacggaatg
aatgtgaacttggggatagggatgccgacgcttgtagccaatgagataccgaatgattat
aacgtcctgcttcagtctgaaaacggcttgctcggaatcgggccttatccggcggaagga
acggaggaccccgatctgatcaatgcgggaaaagaaaccattaccgaggtaaagggagcc
tcgtattttgacagtgccgaatccttcgccatgattcgcggcggccacattgatgtagcg
atcctcggcgggatggaagtgtccgaacggggagatttggcgaactggatgatccccgga
aaaatgatcaaaggaatgggcggcgccatggacctggtccacggagcaaaacggattatt
gtcattatggagcatgttaataaatatggggaatctaaagtgagaacggaatgtacgctg
cctttaaccggcaggcaggtggtcgatcggctgatcacagatttggctgtattcgatttt
catgatggccgtatgacgctcaccgaactgcaggaaggtgtaacaatagaggaggtcttt
gagaaaacagaaggtcattttactgtcagccagtcgttaaaaaacggggtcagaccaaaa
tga

DBGET integrated database retrieval system