KEGG   Bacillus velezensis CAU B946: BACAU_3154Help
Entry
BACAU_3154        CDS       T01692                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00051  Fructose and mannose metabolism
baq00562  Inositol phosphate metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
baq01230  Biosynthesis of amino acids
Module
baq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
baq_M00002  Glycolysis, core module involving three-carbon compounds
baq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_3154 (tpiA)
   00051 Fructose and mannose metabolism
    BACAU_3154 (tpiA)
   00562 Inositol phosphate metabolism
    BACAU_3154 (tpiA)
Enzymes [BR:baq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BACAU_3154 (tpiA)
Exosome [BR:baq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BACAU_3154 (tpiA)
  Exosomal proteins of bladder cancer cells
   BACAU_3154 (tpiA)
  Exosomal proteins of melanoma cells
   BACAU_3154 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCF06688
Position
complement(3355320..3356081)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKVVAESFSQETADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaagccgttgtt
tgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaactgacctgaaa
gtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggtgaaatcagcccg
gtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgcttttaaacacggc
attgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccggaaaaacaaat
gatcttgttgccgatcaagtgaaaaaagggcttgcgggtctttctgaagagcaagtagcc
gcttctgttattgcgtacgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcaaacgacgtctgcgcgcatatccgtaaagtcgttgctgaaagcttcagtcag
gaaactgctgacaagctccgcattcaatacggcggcagcgtaaaacctgcaaatattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagccttgaaccg
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system