KEGG   Bacillus velezensis CAU B946: BACAU_3317Help
Entry
BACAU_3317        CDS       T01692                                 

Gene name
tagD
Definition
(GenBank) hypothetical protein
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:baq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BACAU_3317 (tagD)
Enzymes [BR:baq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     BACAU_3317 (tagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn Pantoate_ligase NuiA
Motif
Other DBs
NCBI-ProteinID: CCF06851
Position
complement(3525648..3526037)
Genome map
AA seq 129 aa AA seqDB search
MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILE
TIRYVDEVIPENSWDQKVRDVADHNIDVFVMGDDWEGKFDFLKDQCEVIYLPRTEGISTT
QIKKEIAGV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggtcattacttacggaacgtttgatttactgcattggggtcatattaaactg
cttgagcgcgcaaagcagcttggagattacctagttgttgccatctcaacagacgagttc
aacctgcaaaaacaaaaaaaggcctaccacagctatgaacacagaaagctgattctggaa
acgatccgttatgtcgacgaagtcattccggaaaacagctgggatcaaaaagtacgtgac
gtagcggatcacaacatcgacgtgttcgtaatgggagacgattgggaaggcaaattcgat
ttccttaaagatcaatgcgaagtcatctatctccctagaaccgaaggcatttccaccaca
cagattaaaaaagaaattgccggggtgtaa

DBGET integrated database retrieval system