KEGG   Bacillus velezensis CAU B946: BACAU_3714Help
Entry
BACAU_3714        CDS       T01692                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00010  Glycolysis / Gluconeogenesis
baq00030  Pentose phosphate pathway
baq00051  Fructose and mannose metabolism
baq00680  Methane metabolism
baq01100  Metabolic pathways
baq01110  Biosynthesis of secondary metabolites
baq01120  Microbial metabolism in diverse environments
baq01130  Biosynthesis of antibiotics
baq01200  Carbon metabolism
Module
baq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACAU_3714 (fbp)
   00030 Pentose phosphate pathway
    BACAU_3714 (fbp)
   00051 Fructose and mannose metabolism
    BACAU_3714 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BACAU_3714 (fbp)
Enzymes [BR:baq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BACAU_3714 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: CCF07248
Position
3913987..3915912
Genome map
AA seq 641 aa AA seqDB search
METKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHGFDTKEALNEWYKETIHRMIKLV
SYCSSKYTRSKLRKALPAQFAYISEELLYKTEQAANKEQYYSEIIEQIIALGQADKLITG
LAYSTQRLVVDHLHVVGDIYDRGPQPDKIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPSFRPKADENRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDRNEITLNGKTYQLENTCFATVNP
KQPDELLEEEAEVMDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
SMETMMIEDKAYAGRELLDVFERFLREAFAHPEETDDLATDMTWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILKEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELMKEVAILEKLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaccaaatatttagatctgctcgcacaaaaatacgattgtgaagaaaaagtggtc
acggaaatcattaatctgaaagcgatactgaacctgccgaaaggaaccgagcatttcgtc
agtgatctgcacggggagtaccaggcattccagcacgtgctgcggaacggttcaggaaga
gtaaaagagaagatccgcgatattttcagcggcgtcatttacgatagagaaattgatgaa
ttggcggctttggtctattacccggaagacaaactgaagctgatcaaacatggctttgat
acgaaagaggcattaaacgagtggtataaagaaacgattcatcggatgattaagctcgtt
tcttattgttcttccaagtacacccgatccaaattgcgcaaagcactgcccgcccaattt
gcttatatttccgaagagctgctgtacaaaacagaacaagccgccaacaaggaacaatac
tactccgaaatcatagaacagatcattgcgctcggccaggccgataagctgatcaccggt
cttgcctacagcacgcagcgattggtggtcgaccatctgcatgtggtcggcgatatttac
gaccgcggaccgcagccggataaaatcatggaagaactgatcaactatcattcagtggat
attcaatgggggaatcatgatgttctctggataggcgcttattccggctcaaaagtatgc
ctggcaaatattatccgcatctgtgcccgctatgacaatctggatattattgaagacgtt
tacggcatcaatctgagaccgctattgaaccttgccgaaaaatattacgatgataacccg
tctttccgtccgaaagcggacgaaaacagaccggaagatgagattaaacaaatcacaaaa
attcatcaggcgatcgcgatgatccaattcaagcttgagagcccgattattaagagacgg
ccgaactttaatatggaggaacggctgttactggaaaagatcgattatgaccgcaatgaa
atcacgctgaacggaaaaacgtatcaactggaaaacacctgctttgcgacggtgaatccc
aaacagcctgacgagctgctagaagaagaagcagaagtcatggacaagctgctgttttct
gtccagcactccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctg
tatctgaaatataacggcaacctgttgattcacggctgtattcccgtcgatgaaaacggc
agcatggaaacgatgatgatagaggataaagcttatgcaggccgtgagctgctcgatgta
tttgaacggttcttacgggaagcgtttgcccatccggaagaaaccgatgatctggcgaca
gatatgacgtggtacttatggacaggcgaatactcctccctcttcggaaaacgggccatg
acaacctttgagcggtatttcattaaagagaaggaaacgcataaagaaaagaaaaaccca
tattactatttgcgtgaagacgaggcaacctgccgaaacatcctgaaggaattcggcctc
aatccggatcacggccatatcatcaacggccatacaccggtaaaagaaatcgaaggcgaa
gatccgatcaaggcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctcttatacaattcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggccgaagtgctgagcaccggaaccgacgtctta
acagtgaaacgattagtcgacaaagagctggagcggaagaaagtaaaagaaacaaacgtc
ggtgaagaactgatgaaagaagtggcgattttggagaaactgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system