KEGG   Bacillus anthracis Ames Ancestor: GBAA_0675Help
Entry
GBAA_0675         CDS       T00178                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GBAA_0675
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GBAA_0675
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GBAA_0675
    1.1.1.-  
     GBAA_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N CoA_trans Gp_dh_N CMAS
Motif
Other DBs
NCBI-ProteinID: AAT29779
UniProt: Q81V29
Position
693376..694428
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNSLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagttaaatggtgtggtatctgcgggacagac
ttgcatgaatatttagcaggacctatttttattccgacagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacgtatgaacaaggtgctcttgtagaaccagcagcagtagcg
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagcagtagcagtctttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttgaatccagcgactcaagatgtattagctgaaattcgcaacttaacaaatagtttaggt
gtaaatgtaagctttgaagtaactggtgttgaagtagtacttcgtcaagcaattgaaagc
acaagctttgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaataatcttgtactaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggtcaaattcaagcagagaaattaattacg
aaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system