KEGG   Bacillus anthracis Ames Ancestor: GBAA_1251Help
Entry
GBAA_1251         CDS       T00178                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01130  Biosynthesis of antibiotics
bar01230  Biosynthesis of amino acids
Module
bar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GBAA_1251
Enzymes [BR:bar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GBAA_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAT30341
UniProt: Q81TM0
Position
1206200..1206961
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVNQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEECGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELEIAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtaaatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagaaaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcatcgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
cacgttgatgtacgaaaacaagtgaagacatatgaagaatgcggcgctggtgcagtttct
gttttaacagacggtcaattttttaaagggtcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttactaatcgtagcggcgttaacgaaagagaaa
ttaaaagagttgtatagctacgtactagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaattgcaattcaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcgggattcattcaaaagaagacataatc
cgcgttaaacgagctggggcaaaaggtgtattagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system