KEGG   Bacillus anthracis Ames Ancestor: GBAA_1446Help
Entry
GBAA_1446         CDS       T00178                                 

Definition
(GenBank) cbiX domain protein
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00860  Porphyrin and chlorophyll metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GBAA_1446
Enzymes [BR:bar01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     GBAA_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: AAT30545
UniProt: Q81T43
Position
1368365..1369120
Genome map
AA seq 251 aa AA seqDB search
MKAILYICHGSRLKAAKEEAVAFITSCMNRVEVSIQEICFLELASPTIDEGFRTCVKRGA
TEIIVIPVFLLAAGHVKKDIPFELEKLNNQYPSIKVTYGNPFGVSEALIKSVYSGSGIEQ
ENKNEVTLLLVARGSSDPEVLRDINWIASLFQKEEKIKKVEVCYLAAAEPKFEEKLKEVV
ERKEKNIVVLPYLLFTGLLMKHIEKEVRQYELDEIKISPYLGKNEAFQYMLIQKTKKLLK
GDQYVSTYSAS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcttatatatatgtcatggaagtcgcttgaaagcagctaaagaagaagcg
gttgcatttattacgtcatgtatgaaccgtgtagaggtaagtattcaagaaatttgtttt
ttagagttagcgagtccaactattgatgaagggttccgtacatgtgtgaagcgtggtgct
acagagattatcgttattccagtttttttattagcagcaggtcatgtaaaaaaagatatt
ccgtttgaattggaaaagttaaataatcaatatccaagtattaaagtgacctatggtaat
ccatttggcgtatcagaagcacttataaaatcagtgtatagcggaagtggcattgaacag
gaaaataagaatgaagtgacgttacttctcgttgcaagagggagcagtgatcctgaagta
ttaagagatataaactggattgcttctttatttcaaaaggaagagaagattaagaaagta
gaagtttgttacttagcggctgccgagccgaaatttgaggagaagttaaaggaagttgta
gaacgaaaagaaaagaatatcgttgtgctgccttacttgttatttacaggtttacttatg
aaacatattgaaaaagaagtgcgccaatatgagctagatgagataaaaataagtccgtat
ttaggaaagaatgaagcgtttcagtatatgttaattcagaaaacgaagaaattattgaag
ggagatcaatatgtatccacttacagtgcgagttga

DBGET integrated database retrieval system