KEGG   Bacillus anthracis Ames Ancestor: GBAA_1447Help
Entry
GBAA_1447         CDS       T00178                                 

Definition
(GenBank) siroheme synthase, precorrin 2 oxidase and ferrochelatase domains
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00860  Porphyrin and chlorophyll metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GBAA_1447
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     GBAA_1447
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     GBAA_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M YtxH Shikimate_DH Pyr_redox_2 CoA_binding_2 DUF711
Motif
Other DBs
NCBI-ProteinID: AAT30546
UniProt: A0A0F7RH60
Position
1369095..1369712
Genome map
AA seq 205 aa AA seqDB search
MYPLTVRVEKKRVVVIGGGKVAGFKIIPLLKQGADIVVVSPELDANLVKLVEEKKIRWYQ
REYEKSDINGAFLVVAASSDAVLNEKVAEDTAENQLVNVITNPESGNVHFPAAFHRGLLN
IAVSTGGASPKLAKKIRDDIANKYDEAYESYLDFLYEVRIKVKELQIEKRERNILLQEVL
KSIYVQNEQKRELFLQELERRVHIG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtatccacttacagtgcgagttgagaagaaacgtgttgttgtcattggtggagggaaa
gttgcgggatttaaaattattcctttgctaaaacaaggtgcagatatagttgtggtaagt
cctgaattggatgcgaatttagtgaaacttgtagaagaaaagaaaattcgttggtatcaa
agagaatatgaaaaaagtgatattaatggtgcttttttagttgtagccgcgagtagtgat
gccgtattgaacgaaaaggttgctgaagatacggcagaaaatcagctggtaaatgttatt
acgaatccggaaagtggaaatgttcattttccggcggcgtttcatcgtgggctacttaat
atagctgtttctaccgggggagcgagtccgaaacttgcaaaaaaaattcgagatgatatc
gcaaataaatatgatgaggcgtatgaatcatatcttgattttttatacgaagttagaata
aaggtgaaagaattacaaatagagaaaagagagagaaatatattgttgcaagaggtattg
aagtcaatatatgttcaaaatgaacaaaaaagagaattgtttttacaagaattagagaga
agagttcatataggatga

DBGET integrated database retrieval system