KEGG   Bacillus anthracis Ames Ancestor: GBAA_2974Help
Entry
GBAA_2974         CDS       T00178                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00020  Citrate cycle (TCA cycle)
bar00620  Pyruvate metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01200  Carbon metabolism
Module
bar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GBAA_2974 (mqo)
   00620 Pyruvate metabolism
    GBAA_2974 (mqo)
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     GBAA_2974 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAT32091
UniProt: Q81P44
Position
2741505..2743007
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKSDGSIDISKAVKVNEQFQLSRQFWAYLVKSKLIRNPQDFIMPLPHMSLV
QGEKNVEFLKNRFEALSKNPLFQGMEFSDAPETLKKWLPLIMEGRTSNEPMAATKIDSGT
DVNFGALTRMLFDYLKTKDVELNYKHSVENIKRTKNGLWEVKVHDMNSGKIEHHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNQKVVEQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEMGLTKY
LIQQVMLSHEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPSRMVEWEGKIKEMIPSYGISLTENPRLFQ
DLHTSTGRTLGLNEKETVHN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgcaggaattatgagtgca
acgttaggctcattactaaaagaattagcacctgaatgggaaattaaagtttttgaaaaa
ctcgcaagtgccggggaagaaagctctaacgaatggaataatgcaggtacagggcattct
gcgctatgcgaactgaactatacttccgaaaaatctgacggatctatagatattagtaag
gctgtaaaagtgaatgagcaattccagctttcaagacaattttgggcatatcttgtaaaa
agcaaattaattcgtaatccacaagattttattatgcctctacctcatatgagtttagta
caaggtgaaaaaaatgttgagtttctaaaaaaccgttttgaagcgctttcaaaaaatcca
ctgtttcaaggaatggaattttctgatgctcctgaaacattaaaaaaatggcttccactc
attatggaaggtcgtacatctaatgaaccgatggctgcaacgaagattgactctggaaca
gatgttaacttcggtgcattaacacgtatgctgtttgattacttaaaaacgaaagatgtc
gagctaaactacaaacatagtgtcgaaaacattaaacgtacgaagaatggtttgtgggaa
gtgaaagtacacgatatgaatagtggtaaaatcgaacatcatactgcaaaattcgtcttt
atcggcggtggtggaggtagcctacctctcctacaaaagactggtattcccgaatcaaaa
catattggtggattcccagtaagtggactatttatggtatgtaagaaccaaaaagttgta
gagcaacatcatgcgaaagtatacggtaaagctaaagttggcgctccgccaatgtctgta
cctcaccttgatacgagatatatagacaataaaaaagctttactattcggaccgttcgca
gggttttctcctaagttcttaaaaactggctcaaaccttgacttaatcggttctgtaaaa
ccgaataacgtcttaacgatgttagctgctggtgtaaaagaaatgggattaacaaaatac
ttaattcagcaagttatgttatcacatgaaaaacgtatggaagaattacgcgaattcatt
ccgaacgcgaaaagtgaagattgggatattgtagttgctggtcagcgtgtacaagtaatt
aaagatactgatgctggcggtaaaggaacacttcaattcggtacagaagttgttagtgcg
gctgatggatcaatcgcagcattactaggtgcttcaccgggtgcttctactgccgttcac
gttatgcttgaagtattagaaaaatgtttcccaagtcgaatggtagaatgggaaggaaaa
ataaaagaaatgattccttcttacggcatttcattaacagaaaatccaagattattccaa
gacctccacacttctacaggtcgtacccttggattaaatgaaaaagaaacggttcataat
taa

DBGET integrated database retrieval system