KEGG   Bacillus anthracis Ames Ancestor: GBAA_4256
Entry
GBAA_4256         CDS       T00178                                 

Gene name
mtnX
Definition
(GenBank) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00270  Cysteine and methionine metabolism
bar01100  Metabolic pathways
Module
bar_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GBAA_4256 (mtnX)
Enzymes [BR:bar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     GBAA_4256 (mtnX)
SSDB
Motif
Pfam: HAD Put_Phosphatase UMPH-1 Hydrolase HAD_2
Other DBs
NCBI-ProteinID: AAT33373
UniProt: Q81MJ1
Position
3894471..3895130
AA seq 219 aa
MSIQVFCDFDGTITNNDNIMSIMEKFAPPEAEEVKNRILSQELSIQEGVSQLFQLIPTNL
HDEIIQFLIETAEIRNGFHEFIQFVNENNISFYVISGGMDFFVYPLLQGLIPKEQIYCNE
TDFSNEYITVNWPHPCDRLCQNHCGLCKSSLIRKLSDTNDFHIVIGDSITDLQAAKQADK
VFARDFLITKCEENHISYTPFETFHDVKTELKHLLEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtattcaagtattttgtgatttcgatggcacgattacaaataatgataacattatg
tccattatggagaaattcgcaccaccagaagctgaagaagtaaagaatagaattttatca
caagagctatctattcaagaaggtgtttctcaattatttcaattaatacctactaatctg
cacgatgaaattattcaatttttaatagagactgctgaaattcgtaatggttttcatgaa
tttatacaatttgtaaatgaaaacaatatttccttttatgttatatcaggtggaatggat
ttcttcgtctatccactcttacaaggactcattccaaaagagcaaatttactgtaatgaa
acagatttttcaaatgaatacattacggtgaattggcctcatccttgtgatcgtctttgt
caaaatcattgcggattatgtaaatcatcactcatccgtaaattgagtgatacgaatgac
ttccatattgtaattggagattcaattaccgatttacaagctgcaaaacaagcggataaa
gtgttcgctcgtgatttccttattacaaaatgcgaagaaaatcatatttcttatacacca
tttgaaacgtttcacgatgttaaaactgaattaaaacatttgttggaggtgaaattatga

DBGET integrated database retrieval system