KEGG   Bacillus anthracis Ames Ancestor: GBAA_4587Help
Entry
GBAA_4587         CDS       T00178                                 

Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00790  Folate biosynthesis
bar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GBAA_4587
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bar04147]
    GBAA_4587
Enzymes [BR:bar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     GBAA_4587
Exosome [BR:bar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBAA_4587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a FBA
Motif
Other DBs
NCBI-ProteinID: AAT33706
UniProt: A0A1S0QP42
Position
4168636..4168950
Genome map
AA seq 104 aa AA seqDB search
MMLRLTEEEVQEELLKLDKWVVKDEKWIERKYMFSDYLKGVEFVSEAAKLSEEHNHHPFI
LIQYKAVIITLSSWNAKGLTKLDFELAKQFDELFVQNEKAVIRK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacgattaactgaagaagaagttcaagaggaattattaaagttagataaatgg
gtagtaaaagatgaaaaatggattgaaagaaaatatatgttttccgactacttaaaagga
gtcgaatttgtctctgaagccgccaaactatcagaagaacataatcaccacccatttatc
cttatccagtataaagcagtcattattactttgtcatcttggaatgcaaaaggtttaacg
aaactcgattttgagcttgcgaagcaatttgatgaactatttgtccaaaatgaaaaagcc
gttataagaaagtaa

DBGET integrated database retrieval system