KEGG   Bacillus anthracis Ames Ancestor: GBAA_4599Help
Entry
GBAA_4599         CDS       T00178                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00010  Glycolysis / Gluconeogenesis
bar00071  Fatty acid degradation
bar00350  Tyrosine metabolism
bar00620  Pyruvate metabolism
bar00625  Chloroalkane and chloroalkene degradation
bar00626  Naphthalene degradation
bar00650  Butanoate metabolism
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GBAA_4599
   00620 Pyruvate metabolism
    GBAA_4599
   00650 Butanoate metabolism
    GBAA_4599
  Lipid metabolism
   00071 Fatty acid degradation
    GBAA_4599
  Amino acid metabolism
   00350 Tyrosine metabolism
    GBAA_4599
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GBAA_4599
   00626 Naphthalene degradation
    GBAA_4599
Enzymes [BR:bar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GBAA_4599
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GBAA_4599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 RapA_C
Motif
Other DBs
NCBI-ProteinID: AAT33720
UniProt: Q81LL7
Position
complement(4176462..4179065)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGRKALQALESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKKDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSVAAAKTVYDAAVKAGAPKHCIQWIE
KPSVEATKQLMNHEGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHIKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMITNDCYFVTEEERRKLEKLVINENT
CAVNSDIVGKSAQYIAELVGITVPKNTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSVNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVAHYLRKHANDVKVEVFFEVEPDPSDETVFKGAEMMRS
FQPDVIIALGGGSAMDAAKGMWLFYEYPETTFYGIKQKFLDIRKRTCKYPELGSKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVLANDYTDGLALKAIDLVFKYLPRAFKDGHDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSVAEGVESLDKAIIDLGKSLNINMSIAGQGVAKDQFEEVVGLLAERAFE
DQCTTANPKLPLISELKEIYMKAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaggaagtaaaagagatgattgatacg
ttagtgaataacggtcggaaggctttacaagcattagaaagttttacacaagagcaaatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgcctcttgcgaag
ttggctgttgaagaaacaggtcgtggtgtatacgaagataaatgcattaaaaatattttt
gctactgaatatatttggcatagcataaagaaagataaaacagtagggattattcacgaa
gaccctcatgaagaaataatagaaattgcggagcccgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacatcgacaacaatgtttaaagcattaatagcgataaaaacgaga
aatccaattattttcgcatttcatccttcagcacaaaactgttctgttgcagccgcgaaa
acagtatacgatgcagcggtgaaggcgggggcaccaaaacattgtattcagtggattgaa
aagccttctgtcgaagcaacgaaacaattaatgaaccatgaaggtgttgcgcttgtttta
gcaactggaggggctggtatggtgaaatcagcttattctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccatgttatatagagaaatcagcgcatataaaacgagcggtt
aatgatttgattttatcaaaaacgtttgataacgggatgatttgtgcatcagaacaagca
atcattgtagacaaggaaatttatgatgatgtgaaaacagaaatgattacaaatgattgt
tactttgtaacagaggaagagagaagaaaattagaaaagcttgttattaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatctgcacagtatattgccgaattagttgga
attactgtacctaaaaatacaaaaatgcttgtagctgaaatacaaggcatcggagccgca
tatccactatctcgtgagaagttaagtccagtattagcttgtgtaaaagcaaattcatta
gaagaaggatttacatattgtgaagaaatgttaaacctcggtggcttagggcattcagca
gttatccattctgtaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgc
cgccttattgtaaatgctccttcatcacaaggtggaatcggtgacatatataatggattt
attccatcacttacgcttggctgcggttcctacgggaaaaactcggtttctcaaaacgta
acagcgacgcacttattaaatataaaaaggttggcaaatagaaaaaagaatatgcagtgg
ttcaaattaccaccaaaaatttattttgaaaaacatgcgacagcatatttagcaaatatg
cctaacatttcacgtgcgtttattgtaacggatccaggaatggttgagcatggatatgta
gatacggtcgcgcattatttacgtaaacatgcaaatgatgtgaaagtagaagttttcttt
gaggttgagccagatccatcagatgaaactgtttttaaaggtgcggaaatgatgagaagt
tttcagcctgatgtcatcatcgcacttggtggtggttcagcgatggatgcagcgaaaggg
atgtggcttttctatgagtacccagaaacaacattctatggaattaaacagaagttttta
gatataagaaaacgtacatgtaaatatccggaattaggaagtaaggcgcagtttgttgcc
attccaacaacatctggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccacttgccgattatgaattaacgccagatgtagcaattgtt
gatccgcaatttgtaatgacagtaccaccacatgtaacagcagatactgggatggacgta
ttaacgcatgcaatcgaggcatatgtgtctgttttagcaaatgattatacagatggatta
gcattaaaggccattgatctcgtatttaaatatttaccaagagcatttaaagatggacat
gatgaagaagcacgagaaaaaatgcataatgcttctgcaattgcagggatggcatttgca
aatgcattcctaggtattaatcacagtttagcgcataaaattggaccagaattccatatt
ccgcatggacgtgcgaatgcaattcttatgccgcacgtaattcgttataatgctattaag
ccaagaaaacatgcattgttcccaaaatatgagcactttgtggctgatgaacgctatgca
catattgcgagaatgctcgggctaccagcaagttcggtggcagaaggtgtagaatcactc
gacaaagcaattattgatctcggaaaaagtttaaatataaatatgagtattgcgggacaa
ggagttgctaaagaccaatttgaagaggttgttggattattagcagaaagagcttttgaa
gatcaatgtacaacagctaatccgaaattacctctcatttcagagctgaaagaaatttat
atgaaagcatataaaggtgagtaa

DBGET integrated database retrieval system