KEGG   Bacillus anthracis Ames Ancestor: GBAA_5278Help
Entry
GBAA_5278         CDS       T00178                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00450  Selenocompound metabolism
bar00970  Aminoacyl-tRNA biosynthesis
bar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GBAA_5278
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GBAA_5278
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bar01007]
    GBAA_5278
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bar03016]
    GBAA_5278
Enzymes [BR:bar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GBAA_5278
Amino acid related enzymes [BR:bar01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GBAA_5278
Transfer RNA biogenesis [BR:bar03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GBAA_5278
 Prokaryotic type
   Other AARSs
    GBAA_5278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AAT34410
UniProt: Q81XF9
Position
complement(4782452..4784086)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKEIANKYHEEFERCFRNLGFTYDCYTRTDSEHHHETVQNVFLRLLEEGHIYKKTV
EQAYCETCTQFLPDCYVEGVCPHCHEEARGDQCDACSAILDPLDLLEKKCKLCGSTPSIQ
ETEHFYFALHTFQEQIKRAVEIAKQTGTWRDNAIQLTERYVKEGLLDRAVSRDLPIGVPI
PVEGYEDKKIYVWIEAVTGYYSASKHWAEETGKDDREFWDGEAKTYYVHGKDNIPFHSVI
WPAVLLGIGEGTIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYDPDSIRYFLIVNA
PENRDTDFSWREFIYSHNSELLGAYGNFVNRTLKFIEKYYGGIMPKGSIDVELKDKIERL
YKHVGEAIEQTKFKVALESIFDAVRFANKYFDERQPWKEREDDPVSCEETIYNCVYLIAN
FANLLEPFLPFSSERIRNTLSIVNRNWEPQHTLPSRIDSVQPLFERIDVKQIECELEKLY
GAVK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattgggggcgcttggccgtatgcaaatggttcgttacatcttggacat
attgcgagtttgttacctggagatattttagcacgttattaccgggcaaaaggtgagaat
gtgttgtatgtttcggggagtgattgcaatggaacaccaattgcaattcgggcaaaacaa
gaaggtgtgacggcgaaggaaattgctaataagtatcatgaagagtttgagcgatgtttt
cgtaaccttggttttacgtatgattgctatacacgtacagatagtgagcaccatcatgaa
acggttcaaaatgtttttttacgtttattagaagaaggacatatttataaaaaaacagta
gaacaagcatattgcgaaacgtgtacacagtttttacctgattgttatgtagaaggtgtt
tgtccacattgccatgaagaggcaagaggagatcaatgcgatgcgtgttcagctatttta
gatccactcgatttgttagaaaagaaatgtaagttatgtggtagtacaccatccatacag
gaaacagagcatttctatttcgcattgcatacatttcaggagcaaattaaaagggctgta
gaaatcgctaaacaaacaggaacatggcgcgacaatgcgattcaactaacagagagatat
gtaaaggaaggattactagatagggccgtatcacgtgatttaccaatcggggtaccaatt
ccagtagaagggtatgaagataagaaaatttacgtatggattgaagcagtgacagggtat
tattcagcaagtaaacattgggctgaagaaacagggaaagatgatcgagagttttgggat
ggcgaagcgaaaacatattatgtgcacggaaaggataatattccgtttcattccgtcatt
tggccagcggtcttacttggaataggagaagggacaattcctcgtcatatcgtttcgaat
gaatatttaacagttgaaaaaagaaaattatctacgagtaaaaactgggcagtatgggtg
cctgatatattagaacgttatgatccagattctattcgttactttttaatagtaaatgca
ccagaaaatcgtgacactgacttttcatggcgtgaatttatttacagtcataatagtgaa
ttgttaggtgcatacgggaactttgtgaaccgaacattaaagtttattgaaaaatattat
ggtggtatcatgccgaagggaagtattgatgtagagctaaaagataagatagaaagatta
tataaacatgtaggagaggcgattgagcaaactaaatttaaggtggcattagaatcaata
tttgatgcagtacgttttgcaaataaatactttgatgagaggcagccatggaaagaaagg
gaagatgatccagtttcatgcgaagaaacgatttataattgtgtgtatctcatcgctaat
tttgcaaatctcctggaaccatttttaccattttcaagtgaaagaattagaaacacatta
tcgattgtgaaccgaaattgggagcctcaacatacgttgccaagtagaattgatagtgta
cagccactatttgaacgaatcgatgtaaaacaaattgagtgtgagttagaaaagctatat
ggagcggtaaagtga

DBGET integrated database retrieval system