KEGG   Bacillus anthracis Ames Ancestor: GBAA_5573Help
Entry
GBAA_5573         CDS       T00178                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00240  Pyrimidine metabolism
bar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    GBAA_5573 (tdk)
Enzymes [BR:bar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GBAA_5573 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 UvrD-helicase zf-C4_ClpX
Motif
Other DBs
NCBI-ProteinID: AAT34716
UniProt: Q81JX0
Structure
PDB: 

Position
complement(5057900..5058484)
Genome map
AA seq 194 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcagaacggttggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagcttatccgccgtgttcgtcgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttaaacatatcactgaa
gaaatggatgtaattgcaattgatgaagtgcaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaaa
ctacaagctgtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccaattattttagttggtgcttcagagtcgtatgaa
ccacgctgtcgtcattgtcatgcagttcctacaaaacaaagataa

DBGET integrated database retrieval system