KEGG   Bacillus anthracis Ames Ancestor: GBAA_5589Help
Entry
GBAA_5589         CDS       T00178                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00071  Fatty acid degradation
bar00072  Synthesis and degradation of ketone bodies
bar00280  Valine, leucine and isoleucine degradation
bar00310  Lysine degradation
bar00362  Benzoate degradation
bar00380  Tryptophan metabolism
bar00620  Pyruvate metabolism
bar00630  Glyoxylate and dicarboxylate metabolism
bar00640  Propanoate metabolism
bar00650  Butanoate metabolism
bar00900  Terpenoid backbone biosynthesis
bar01100  Metabolic pathways
bar01110  Biosynthesis of secondary metabolites
bar01120  Microbial metabolism in diverse environments
bar01130  Biosynthesis of antibiotics
bar01200  Carbon metabolism
bar01212  Fatty acid metabolism
bar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBAA_5589
   00630 Glyoxylate and dicarboxylate metabolism
    GBAA_5589
   00640 Propanoate metabolism
    GBAA_5589
   00650 Butanoate metabolism
    GBAA_5589
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GBAA_5589
   00072 Synthesis and degradation of ketone bodies
    GBAA_5589
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBAA_5589
   00310 Lysine degradation
    GBAA_5589
   00380 Tryptophan metabolism
    GBAA_5589
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBAA_5589
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GBAA_5589
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GBAA_5589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bar04147]
    GBAA_5589
Enzymes [BR:bar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GBAA_5589
Exosome [BR:bar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBAA_5589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAT34734
UniProt: Q81JV5
Position
complement(5072261..5073442)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKKIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggtggggaaatttggaggatct
ttaaaagatgtaaaagcaacagaacttggaggaatcgcaattaaagcagcgcttgaaaga
gcgaatgtttcagctagtgatgttgaggaagttatattcggaacggttattcaaggtgga
cagggacaaattccatcacgccaagctgcaagggctgctggaatcccttgggaagtgcag
acggaaactgtcaataaagtttgtgcatcagggcttcgtgcggtgactttagcggatcaa
attattcgtactggcgatcaatcactaattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatacagaatgggtaacaacgaagtcatt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaggatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcagtttcagcgcataaagaaggacgttttgaagaggaaatcgtg
ccagtaacgattccacaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgccg
cgtgaagatacaacaattgaaaaactagcaaaattaaaacctgtatttgataagacagcg
acggtgacagctggtaatgcaccagggctaaacgatggtggcgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgaggacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagaaaattgaagacatcgatttatttgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtggcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system