KEGG   Bacillus anthracis Ames Ancestor: GBAA_pXO1_0142
Entry
GBAA_pXO1_0142    CDS       T00178                                 

Gene name
cya
Definition
(GenBank) calmodulin-sensitive adenylate cyclase
  KO
K11029  anthrax edema toxin adenylate cyclase [EC:4.6.1.1]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar00230  Purine metabolism
bar01100  Metabolic pathways
Module
bar_M00859  Bacillus anthracis pathogenicity signature, anthrax toxin
Brite
KEGG Orthology (KO) [BR:bar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GBAA_pXO1_0142 (cya)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bar02042]
    GBAA_pXO1_0142 (cya)
Enzymes [BR:bar01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     GBAA_pXO1_0142 (cya)
Bacterial toxins [BR:bar02042]
 Type III toxins: Intracellular toxins
  Adenylate cyclase
   Anthrax edema toxin
    GBAA_pXO1_0142 (cya)
SSDB
Motif
Pfam: ATLF Anthrax_toxA
Other DBs
NCBI-ProteinID: AAT28883
UniProt: P40136
Structure
PDB: 

Position
pXO1:122608..125010
AA seq 800 aa
MTRNKFIPNKFSIISFSVLLFAISSSQAIEVNAMNEHYTESDIKRNHKTEKNKTEKEKFK
DSINNLVKTEFTNETLDKIQQTQDLLKKIPKDVLEIYSELGGEIYFTDIDLVEHKELQDL
SEEEKNSMNSRGEKVPFASRFVFEKKRETPKLIINIKDYAINSEQSKEVYYEIGKGISLD
IISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQKFKEKLELNNKSIDINFIKENLTEFQHA
FSLAFSYYFAPDHRTVLELYAPDMFEYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEK
ALKASGLVPEHADAFKKIARELNTYILFRPVNKLATNLIKSGVATKGLNVHGKSSDWGPV
AGYIPFDQDLSKKHGQQLAVEKGNLENKKSITEHEGEIGKIPLKLDHLRIEELKENGIIL
KGKKEIDNGKKYYLLESNNQVYEFRISDENNEVQYKTKEGKITVLGEKFNWRNIEVMAKN
VEGVLKPLTADYDLFALAPSLTEIKKQIPQKEWDKVVNTPNSLEKQKGVTNLLIKYGIER
KPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGDVVNHGTEQDNEEFPEKDNEIFIINPEG
EFILTKNWEMTGRFIEKNITGKDYLYYFNRSYNKIAPGNKAYIEWTDPITKAKINTIPTS
AEFIKNLSSIRRSSNVGVYKDSGDKDEFAKKESVKKIAGYLSDYYNSANHIFSQEKKRKI
SIFRGIQAYNEIENVLKSKQIAPEYKNYFQYLKERITNQVQLLLTHQKSNIEFKLLYKQL
NFTENETDNFEVFQKIIDEK
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgactagaaataaatttatacctaataagtttagtattatatccttttcagtattacta
tttgctatatcctcctcacaggctatagaagtaaatgctatgaatgaacattacactgag
agtgatattaaaagaaaccataaaactgaaaaaaataaaactgaaaaagaaaaatttaaa
gacagtattaataacttagttaaaacagaatttaccaatgaaactttagataaaatacag
cagacacaagacttattaaaaaagatacctaaggatgtacttgaaatttatagtgaatta
ggaggagaaatctattttacagatatagatttagtagaacataaggagttacaagattta
agtgaagaagagaaaaatagtatgaatagtagaggtgaaaaagttccgtttgcatcccgt
tttgtatttgaaaagaaaagggaaacacctaaattaattataaatatcaaagattatgca
attaatagtgaacaaagtaaagaagtatattatgaaattggaaaggggatttctcttgat
attataagtaaggataaatctctagatccagagtttttaaatttaattaagagtttaagc
gatgatagtgatagtagcgaccttttatttagtcaaaaatttaaagagaagctagaattg
aataataaaagtatagatataaattttataaaagaaaatttaactgaatttcagcatgcg
ttttctttagcgttttcttattattttgcacctgaccatagaacggtattagagttatat
gcccccgacatgtttgagtatatgaataagttagaaaaagggggatttgagaaaataagt
gaaagtttgaagaaagaaggtgtggaaaaagataggattgatgtgctgaaaggagaaaaa
gcacttaaagcttcaggtttagtaccagaacatgcagatgcttttaaaaaaattgctaga
gaattaaatacatatattctttttaggcctgttaataagttagctacaaaccttattaaa
agtggtgtggctacaaagggattgaatgttcatggaaagagttcggattggggccctgta
gctggatacataccatttgatcaagatttatctaagaagcatggtcaacaattagctgtc
gagaaaggaaatttagaaaataaaaaatcaattacagagcatgaaggtgaaataggtaaa
ataccattaaagttagaccatttaagaatagaagagttaaaggaaaatgggataattttg
aagggtaaaaaagaaattgataatggtaaaaaatattatttgttagaatcgaataatcag
gtatatgaatttagaattagcgatgaaaacaacgaagtacaatacaagacaaaagaaggt
aaaattactgttttaggggaaaaattcaattggagaaatatagaagtgatggctaaaaat
gtagaaggggtcttgaagccgttaacagctgactatgatttatttgcacttgccccaagt
ttaacagaaataaaaaaacaaataccacaaaaagaatgggataaagtagttaacacccca
aattcattagaaaagcaaaaaggtgttactaatttattgattaaatatggaattgagagg
aaaccggattcaactaagggaactttatcaaattggcaaaaacaaatgcttgatcgtttg
aatgaagcagtcaaatatacaggatatacagggggggatgtggttaaccatggcacagag
caagataatgaagagtttcctgaaaaagataacgaaatttttataattaatccagaaggt
gaatttatattaactaaaaattgggagatgacaggtagatttatagaaaaaaacattacg
ggaaaagattatttatattattttaaccgttcttataataaaatagctcctggtaataaa
gcttatattgagtggactgatccgattacaaaagccaaaataaataccatccctacgtca
gcagagtttataaaaaacttatccagtatcagaagatcttcaaatgtaggagtttataaa
gatagtggcgacaaagacgaatttgcaaaaaaagaaagcgtgaaaaaaattgcaggatat
ttgtcagactattacaattcagcaaatcatattttttctcaggaaaaaaagcgtaaaata
tcaatatttcgtggaatccaagcctataatgaaattgaaaatgttctaaaatctaaacaa
atagcaccagaatacaaaaattattttcaatatttaaaggaaaggattaccaatcaagtt
caattgcttctaacacatcaaaaatctaatattgaatttaaattattgtataaacaatta
aactttacagaaaatgaaacggataattttgaggtcttccaaaaaattattgatgaaaaa
taa

DBGET integrated database retrieval system