KEGG   Bacillus anthracis Ames Ancestor: GBAA_pXO1_0172Help
Entry
GBAA_pXO1_0172    CDS       T00178                                 

Gene name
lef
Definition
(GenBank) anthrax lethal factor endopeptidase
  KO
K08645  anthrax lethal toxin endopeptidase [EC:3.4.24.83]
Organism
bar  Bacillus anthracis Ames Ancestor
Pathway
bar04621  NOD-like receptor signaling pathway
Module
bar_M00859  Bacillus anthracis pathogenicity signature, anthrax toxin
Brite
KEGG Orthology (KO) [BR:bar00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    GBAA_pXO1_0172 (lef)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bar01002]
    GBAA_pXO1_0172 (lef)
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bar02042]
    GBAA_pXO1_0172 (lef)
Enzymes [BR:bar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.83  anthrax lethal factor endopeptidase
     GBAA_pXO1_0172 (lef)
Peptidases and inhibitors [BR:bar01002]
 Metallo peptidases
  Family M34: anthrax lethal factor family
   GBAA_pXO1_0172 (lef)
Bacterial toxins [BR:bar02042]
 Type III toxins: Intracellular toxins
  Metalloprotease
   Anthrax lethal toxin
    GBAA_pXO1_0172 (lef)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Anthrax-tox_M ATLF AsiA Slx4
Motif
Other DBs
NCBI-ProteinID: AAT28913
UniProt: P15917
Structure
PDB: 

Position
pXO1:complement(149357..151786)
Genome map
AA seq 809 aa AA seqDB search
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaaaaagaatttataaaagtaattagtatgtcatgtttagtaacagcaatt
actttgagtggtcccgtctttatcccccttgtacagggggcgggcggtcatggtgatgta
ggtatgcacgtaaaagagaaagagaaaaataaagatgagaataagagaaaagatgaagaa
cgaaataaaacacaggaagagcatttaaaggaaatcatgaaacacattgtaaaaatagaa
gtaaaaggggaggaagctgttaaaaaagaggcagcagaaaagctacttgagaaagtacca
tctgatgttttagagatgtataaagcaattggaggaaagatatatattgtggatggtgat
attacaaaacatatatctttagaagcattatctgaagataagaaaaaaataaaagacatt
tatgggaaagatgctttattacatgaacattatgtatatgcaaaagaaggatatgaaccc
gtacttgtaatccaatcttcggaagattatgtagaaaatactgaaaaggcactgaacgtt
tattatgaaataggtaagatattatcaagggatattttaagtaaaattaatcaaccatat
cagaaatttttagatgtattaaataccattaaaaatgcatctgattcagatggacaagat
cttttatttactaatcagcttaaggaacatcccacagacttttctgtagaattcttggaa
caaaatagcaatgaggtacaagaagtatttgcgaaagcttttgcatattatatcgagcca
cagcatcgtgatgttttacagctttatgcaccggaagcttttaattacatggataaattt
aacgaacaagaaataaatctatccttggaagaacttaaagatcaacggatgctggcaaga
tatgaaaaatgggaaaagataaaacagcactatcaacactggagcgattctttatctgaa
gaaggaagaggacttttaaaaaagctgcagattcctattgagccaaagaaagatgacata
attcattctttatctcaagaagaaaaagagcttctaaaaagaatacaaattgatagtagt
gattttttatctactgaggaaaaagagtttttaaaaaagctacaaattgatattcgtgat
tctttatctgaagaagaaaaagagcttttaaatagaatacaggtggatagtagtaatcct
ttatctgaaaaagaaaaagagtttttaaaaaagctgaaacttgatattcaaccatatgat
attaatcaaaggttgcaagatacaggagggttaattgatagtccgtcaattaatcttgat
gtaagaaagcagtataaaagggatattcaaaatattgatgctttattacatcaatccatt
ggaagtaccttgtacaataaaatttatttgtatgaaaatatgaatatcaataaccttaca
gcaaccctaggtgcggatttagttgattccactgataatactaaaattaatagaggtatt
ttcaatgaattcaaaaaaaatttcaaatatagtatttctagtaactatatgattgttgat
ataaatgaaaggcctgcattagataatgagcgtttgaaatggagaatccaattatcacca
gatactcgagcaggatatttagaaaatggaaagcttatattacaaagaaacatcggtctg
gaaataaaggatgtacaaataattaagcaatccgaaaaagaatatataaggattgatgcg
aaagtagtgccaaagagtaaaatagatacaaaaattcaagaagcacagttaaatataaat
caggaatggaataaagcattagggttaccaaaatatacaaagcttattacattcaacgtg
cataatagatatgcatccaatattgtagaaagtgcttatttaatattgaatgaatggaaa
aataatattcaaagtgatcttataaaaaaggtaacaaattacttagttgatggtaatgga
agatttgtttttaccgatattactctccctaatatagctgaacaatatacacatcaagat
gagatatatgagcaagttcattcaaaagggttatatgttccagaatcccgttctatatta
ctccatggaccttcaaaaggtgtagaattaaggaatgatagtgagggttttatacacgaa
tttggacatgctgtggatgattatgctggatatctattagataagaaccaatctgattta
gttacaaattctaaaaaattcattgatatttttaaggaagaagggagtaatttaacttcg
tatgggagaacaaatgaagcggaattttttgcagaagcctttaggttaatgcattctacg
gaccatgctgaacgtttaaaagttcaaaaaaatgctccgaaaactttccaatttattaac
gatcagattaagttcattattaactcataa

DBGET integrated database retrieval system