KEGG   Bartonella sp. A1379B: BA1379B_003430Help
Entry
BA1379B_003430    CDS       T05185                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
bara  Bartonella sp. A1379B
Pathway
bara03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bara00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BA1379B_003430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bara03011]
    BA1379B_003430
Ribosome [BR:bara03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BA1379B_003430
  Bacteria
    BA1379B_003430
  Archaea
    BA1379B_003430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AQX18185
Position
406752..407141
Genome map
AA seq 129 aa AA seqDB search
MGKAKVPRQLKDIEAKAVARTVRVSPQKLNLVAEMIRGKKVNMALADLAFSRKRIAGTVR
SALESAIANAENNHNLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRVKRPFSHLTIIVR
EVVEKGEVA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagctaaggttccacgccaacttaaagatattgaagcaaaagctgtcgcccga
acagttcgtgtaagtccgcagaagcttaatttggttgctgaaatgatacgtggtaaaaaa
gttaatatggcattggctgatttggcattttcgcgtaagcgtattgctggtactgttcga
agtgctcttgaatcggcaattgctaatgcggaaaataatcataatcttgatattgattcc
ttgattgttgcagaagcatatgttggtaaatctattgtaatgaagcgttttcatgttcga
gggcgtggtcgagctagtcgagtgaagcgtccattttctcatctcactattattgttcgt
gaagttgtagaaaaaggggaggttgcataa

DBGET integrated database retrieval system