KEGG   Candidatus Bathyarchaeota archaeon BA2: AOA66_0195Help
Entry
AOA66_0195        CDS       T04066                                 

Definition
(GenBank) Arginase family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
barb  Candidatus Bathyarchaeota archaeon BA2
Pathway
barb00220  Arginine biosynthesis
barb00330  Arginine and proline metabolism
barb01100  Metabolic pathways
barb01110  Biosynthesis of secondary metabolites
barb01130  Biosynthesis of antibiotics
barb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:barb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AOA66_0195
   00330 Arginine and proline metabolism
    AOA66_0195
Enzymes [BR:barb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AOA66_0195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: KPV64384
UniProt: A0A0P9E7G8
AA seq 87 aa AA seqDB search
MGIIEGFQRALGSRIGLIYMDAHGDFNTPETTPSGLIGGMDVAITAGRGPKELVEMFGRS
PLLLEENIVLYGTRELDAVEEMVPSGI
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgggaataatcgaaggtttccaaagagccctaggctcaagaattggacttatctacatg
gatgcccatggagactttaacactccggagacaacaccttcaggtctcatcggcggcatg
gatgtcgctatcaccgctgggaggggaccaaaagagcttgtggaaatgtttggtcgttct
cccttgcttcttgaagaaaacattgtcctgtacgggacacgcgaactggatgctgtggag
gagatggtccctagcggaatctaa

DBGET integrated database retrieval system