KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_0406Help
Entry
AOA65_0406        CDS       T04065                                 

Gene name
mrtB
Definition
(GenBank) Methyl-coenzyme M reductase II subunit beta
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Pathway
barc00680  Methane metabolism
barc01100  Metabolic pathways
barc01120  Microbial metabolism in diverse environments
barc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:barc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AOA65_0406 (mrtB)
Enzymes [BR:barc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     AOA65_0406 (mrtB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: KPV65184
UniProt: A0A0P9FZR9
AA seq 459 aa AA seqDB search
MGYKDAVDLYDDHSNCLAKDVPIQALSPLYNPYMGEVLDLFKRTAFVDLANLEKCMKLGR
GGWETRIGRDEIQMPWYSRDLPIVERSEEIAKKMKEKMARYGDGKEELVRLILGGKFIVV
KIPERMMKISASRDPALTWTMVALCQAVAETFNLDPETDPSGCNMLNAAVWGRYPQSPEL
PPGGPVFGFLKQSNTVDGLGCGFRGTTINHIVALTNKRTLDAVALTTILEQGAQWETGNA
LGWFERYHLLGAAYQGFNANNLVLDLVKENKEGTIGDVAISTVRRAVEDGIINVKRTFPS
GYKHYATGDFPLWNAYGCAGALAAVIVNCGASRAGQSASSVLAYFGDQLIFETGGLPDPD
AGRLQGAGQGFAFYTHSIYGGAGPGAYTLDHVVVRHTSGFLTPCISAAMCLDSGTQLFSP
EMTSSAFFGLRDEIPLLEEPLKKVAGSAEEVGRKLAKAG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgggatacaaagatgcggtagatctatacgacgatcattccaattgtctagcgaaagat
gtgccaatacaggctctctcccctttatacaatccttatatgggggaagttctggacctc
ttcaagcgaacagctttcgtcgatttagccaatttagaaaaatgcatgaaattggggagg
ggaggctgggaaacacgcatcggaagagatgaaatccagatgccttggtacagcagagac
ctgcccatagtcgagcgctcggaagaaatagccaaaaaaatgaaagagaagatggcgaga
tacggtgatgggaaagaggaactcgtcaggctcattttgggtgggaaattcatcgttgtt
aagattcctgagagaatgatgaaaatctcagctagccgtgaccccgcgctcacttggacg
atggtggccctgtgtcaagctgtagccgaaacttttaacctcgatccagaaacggacccg
agtggttgcaacatgttgaacgcggccgtctggggaaggtatccccaatctcccgaactc
ccccccggtggtcccgtgttcggatttctgaagcagagcaacacggtagatggtcttggg
tgtgggttcaggggaacaacgataaatcacatcgtggctttaaccaataaacgaactctg
gacgctgttgccctgacaacgatcctggagcagggggcccaatgggaaacgggcaacgca
ttgggttggttcgagagataccatctcctcggggcagcctaccaaggcttcaacgcgaac
aatctggtcctagatctcgtcaaagaaaataaggaaggaacaattggggatgtcgcgatc
agcacggtgaggagagcggtggaagatggcatcataaatgtcaaaagaacttttccctcg
ggctacaaacactacgctacgggcgacttcccactttggaacgcgtatggctgtgccgga
gctttggctgcagtgatagtcaattgtggtgccagcagggccgggcaaagtgcctcatcc
gttttggcttatttcggcgatcaattgatatttgagacgggggggttacctgatcccgat
gcagggaggctgcagggtgctggtcagggctttgctttctacactcactccatctatggg
ggtgccggtcccggggcgtatactctagaccacgttgttgtaaggcatacctccggattt
ttgaccccgtgtatatccgcggcgatgtgtcttgattccggaactcagctcttttcacct
gaaatgacttcgagtgctttcttcgggttgagagatgagatacccttgctcgaggaaccg
ttaaaaaaggtagccggttctgccgaggaggttggaagaaaactagcaaaagctggttag

DBGET integrated database retrieval system