KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_0452Help
Entry
AOA65_0452        CDS       T04065                                 

Gene name
cdhC2
Definition
(GenBank) Acetyl-CoA decarbonylase/synthase complex subunit beta 2
  KO
K00193  acetyl-CoA decarbonylase/synthase, CODH/ACS complex subunit beta [EC:2.3.1.169]
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Pathway
barc00680  Methane metabolism
barc01100  Metabolic pathways
barc01120  Microbial metabolism in diverse environments
barc01200  Carbon metabolism
Module
barc_M00422  Acetyl-CoA pathway, CO2 => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:barc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AOA65_0452 (cdhC2)
Enzymes [BR:barc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.169  CO-methylating acetyl-CoA synthase
     AOA65_0452 (cdhC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CdhC
Motif
Other DBs
NCBI-ProteinID: KPV65073
UniProt: A0A0P9I6R8
AA seq 460 aa AA seqDB search
MSMFKDIPVDVGVIYEGQRIRYHDTQVELGGERMDTKFELVRVKPPDEVEDERITVIGPD
IEDMEVGSTHPFGIYIEVAGKQLEEALESVVERRIHAYCNYIEGFMHMNQRYDIFLRLSK
KSFQRGLNSFAYIGKVLIRLFKSELPIIERIQVTFITDPDRVREMLAEAIKIYEARDARA
RGLKDEEVDKFYGCTLCQSFAPTHVCVITPQRYSNCGSISWFDARASARVDPKGPVFEIE
RGEMIDPIKGEFTGVNEAVKRKSLGEISRVWLYTGFGYPHTSCGCFEGAAFYIPEVDGFG
VVHRGFKGVTVNGLPFSTIADSTAGGRQIDGFHGISIEYMRSPRFLQADGGWNRIAWMPS
SVKERVTQFIPKELIEKIPTENDVKTMDELRGFLKDRGHPVAERWVAAPAEVVPEVKEEE
VPAVPVAAVPTMPIAAGGFRIILKDAKIHAKRVIIRTEKR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgtttaaggacatccccgtggatgtgggagtgatttatgaaggccagaggatc
cgataccatgacacgcaggtggagctcggcggggagcgcatggacaccaagtttgagctg
gtgagggtcaagcccccggatgaggtggaggacgagaggataaccgtcatagggccggac
atcgaggacatggaggtggggagcacccaccccttcggcatctacattgaggtggctgga
aaacagctcgaggaggccctcgaaagcgttgtggagaggcgcatccacgcctactgcaat
tacatcgagggcttcatgcacatgaaccaacgctacgacatcttcctgaggctaagcaag
aaatccttccagaggggcctgaactccttcgcttacatcgggaaggtcttgataaggctc
ttcaagagcgagttgcccatcatcgagaggatccaggtcaccttcatcaccgaccccgac
agggttcgggagatgctcgcagaggccataaagatatatgaggcccgtgacgccagagcc
agggggctgaaggatgaggaggtggacaagttttatggctgcacactctgtcagtcgttc
gccccaacccacgtgtgcgtgatcacgccccagcgatactctaattgtgggtccatcagc
tggtttgacgccagggcctcggcgcgagtggaccccaagggcccagtgttcgagattgag
aggggtgagatgatcgacccaatcaagggtgagtttacgggtgtgaacgaggctgtgaaa
aggaagtctctgggggaaattagccgggtctggttgtacacgggattcggttatccccac
acctcatgtggctgctttgagggagccgccttctacatccccgaggtggacggcttcggt
gttgttcataggggctttaagggggtgaccgtcaatgggctgcccttctccaccatagcg
gactccaccgctggtggcaggcagatcgatggattccacggcatatccatcgagtacatg
aggtcgccaaggtttcttcaggctgatgggggctggaaccgaatcgcttggatgccctcc
agcgtcaaggagcgggttacgcagtttattccgaaggagttgatcgaaaaaatccccacg
gaaaacgatgtgaaaacgatggatgagttaaggggcttccttaaggatcgtgggcacccg
gtggctgaacgatgggtagctgcacccgccgaagtggtaccagaggtgaaggaggaggaa
gttccggcagtgcccgtggccgctgttcccaccatgccaatcgccgctggtggattcagg
atcatcctaaaggacgcgaagatccacgcgaagagggtcatcatccgaacggagaagagg
tga

DBGET integrated database retrieval system