KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_0632Help
Entry
AOA65_0632        CDS       T04065                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Pathway
barc00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:barc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOA65_0632
Enzymes [BR:barc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     AOA65_0632
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     AOA65_0632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_oxidored FAD_binding_3 Lycopene_cycl DAO Trp_halogenase HI0933_like Pyr_redox_2 FAD_binding_2 NAD_binding_8 Pyr_redox GIDA AlaDh_PNT_C Thi4 XdhC_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: KPV64919
UniProt: A0A0P9FZC9
AA seq 414 aa AA seqDB search
MNVKADIVVVGAGPCGSFSALTAAKLGAEVVVCEEHREIGFPAHCAGHVSISGLKFLGLD
LPQRIIENEIRGAVFHSPSGEELEIRRASPVSLVVNRKLFDKHLADLAMKAGVQYLLGSR
AESPLLSSGFVKGVTILRGGIKEALASEMVIDAEGCSSILLKRAGLQTLNRSMVVNAIQV
EVDYVDKVNLDTVEVYFGRKFAPGHFAWIIPKRDGSAKVGLATGMGDPREYLQRFMREHP
IASKKLRKSSITDLSLHPIPLGGAIPKTYSNGFLIVGDAASQVKPTTGGGLIPGLLCSKI
AGEVAYEALESNDFSKSSLSSYQSRWKEIIGFDMAVMYQIRRVFNRLSDNRIDKIIDVCA
KSEVNRILEEAADIDFEGRSLIRMARHPATIITALYFVFSSLFSPKMERLNPAK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaaggctgacatcgttgtcgtcggggctggcccgtgcggctccttttcggct
ttgacagcggcgaaactgggtgcagaggttgtagtgtgcgaggagcatagggagataggg
tttcccgcgcactgtgcgggtcatgtaagtataagtggcttaaaatttttgggactagac
ttaccacaaaggatcattgagaacgagatcaggggtgcggtttttcactcgccgtcaggt
gaagaattggagatcagacgcgcctctcccgtgagccttgtagttaacaggaaattgttt
gataagcacctcgcggatcttgctatgaaggccggggtgcaatacctcttagggtcgagg
gccgaatcgcctcttctttcttcaggctttgtcaaaggggttaccattttaaggggaggg
atcaaggaggctctggcatctgagatggtgatagatgctgaagggtgctcgtccatcctc
ctgaagagggctgggctacaaacgctcaacaggtccatggtggtcaacgccattcaagtg
gaagtcgattatgtggataaagtaaacttggatacggttgaggtgtattttggccgaaaa
ttcgcgcctggccattttgcgtggatcattcccaaaagggacggttcagccaaggtgggg
ctagccaccgggatgggcgacccacgggaatatttgcagcgtttcatgcgggaacaccct
atagcatccaaaaaattgagaaaaagcagtatcaccgacctctccttacatcccattccg
cttggaggggccatcccaaaaacatattcgaatgggttcctcatcgtaggggacgcagcc
tcacaggttaaaccaacaaccggaggcggcctcatccctggattgttatgctccaagatc
gcaggtgaagtggcatatgaagccttagaaagcaacgatttttccaaatcatctctgtca
agttaccagtcccgatggaaggagataatcggttttgacatggcggtgatgtatcaaata
aggagggtgttcaaccgactatctgacaacagaatcgacaaaatcatcgatgtatgtgca
aaatcggaggtgaacagaatacttgaggaggcggcagacatagattttgagggaagatcg
ctgatccgcatggcccggcatccagcaaccataatcacagcgttatatttcgtgttttca
tcactattcagccccaagatggaaagattaaaccctgccaaatag

DBGET integrated database retrieval system