KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_0748Help
Entry
AOA65_0748        CDS       T04065                                 

Definition
(GenBank) Hydroxymethylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Pathway
barc00900  Terpenoid backbone biosynthesis
barc01110  Biosynthesis of secondary metabolites
barc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:barc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOA65_0748
Enzymes [BR:barc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     AOA65_0748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: KPV64834
UniProt: A0A0P9ENZ7
AA seq 234 aa AA seqDB search
MSKTSQIPGFYKLSPKERVQIVKGFANLTDEEVGILQSTGSLPLDLADRMIENVVGAIPI
PLGIAVNFLINGKDYLIPISNLATKRLARAWAMVPKEAVGGEEVVDGIVQAYAFAAADPY
RAVTHNKGILNGIIAVVIATCNDHRAVEAGAHVYAAISGHYGPLSIWEKNEKGDLVGSIE
LPMAVGIIGGATRVHPVARAALKILGVKTATGVERSARGRWVGSKSCGAESAGS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacatctcagatccctgggttctataaactgagcccaaaggaaagggtgcag
atcgtaaaggggttcgccaacctaaccgacgaggaggtcgggattcttcaatcaacaggt
tccttgccattagatttggctgaccgcatgatcgagaatgtggttggggcgattcccata
cccttaggaatagccgtaaatttccttatcaacggaaaggactacctaattcccatttcc
aatctagctacgaaacgtttggcgagggcgtgggccatggtgccaaaggaagcggtggga
ggggaggaagtggtcgacggcatcgtgcaagcctatgcctttgccgcagcagacccctat
cgggcggtaacccacaacaagggcatattgaatggcatcattgccgttgtgatagccacc
tgtaacgaccatcgagccgtcgaggcgggggctcatgtgtatgctgccatatcaggtcat
tatggtccactatccatatgggagaaaaatgagaagggggacctcgtgggctccattgag
ttgcccatggctgtgggaatcatcggcggcgccactagggtacacccggtggcgagggcg
gctctaaagattctgggcgtgaagaccgccacaggagttgagcgaagtgctcgcggccgt
tgggttggctcaaaatcttgcggcgctgagagcgctggctcatga

DBGET integrated database retrieval system