KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_0890Help
Entry
AOA65_0890        CDS       T04065                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Pathway
barc00760  Nicotinate and nicotinamide metabolism
barc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:barc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AOA65_0890
Enzymes [BR:barc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     AOA65_0890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like HIGH_NTase1 LigB
Motif
Other DBs
NCBI-ProteinID: KPV64674
UniProt: A0A0P9E0N4
AA seq 175 aa AA seqDB search
MVRRGVFVGRFQPLHNGHMGAIKDMLEKVDELVIVVGSSQYSHRMENPFTVGERITMIRE
ALKEEGIPTSRCWIVPVPDVHIHMIWVAQVVGYTPKFDIVYTNEPLTRRLFIEAGFKVEP
VPFHEREVYSATEIRKRIMNGEDWEELVPKCVAQFIKEVGGVERLRDLAKTDKIT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggcgcggggtttttgtgggaaggttccagccccttcataatgggcacatgggg
gcaataaaggacatgctagagaaggttgacgagctggtgatcgttgtcggtagctcacaa
tacagccataggatggagaatccattcaccgtgggcgagcgcatcaccatgattcgagag
gccctaaaggaggaggggatcccaacatcacgatgttggatcgttcctgtgccagacgtt
cacatccacatgatctgggtagcccaagtggtgggatacaccccaaaatttgacatagtc
tacactaatgagcccctcacacgccgactgttcattgaggctggcttcaaggttgagccc
gtgcccttccacgagcgggaggtctactccgccaccgagatacgaaaaagaatcatgaat
ggtgaggattgggaggagctcgttccaaagtgcgtagcgcagttcattaaggaagttggc
ggcgtggagagactgcgagacttagctaagaccgataaaattacttaa

DBGET integrated database retrieval system