KEGG   Candidatus Bathyarchaeota archaeon BA1: AOA65_1856Help
Entry
AOA65_1856        CDS       T04065                                 

Definition
(GenBank) Phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
barc  Candidatus Bathyarchaeota archaeon BA1
Brite
KEGG Orthology (KO) [BR:barc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AOA65_1856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: KPV62405
UniProt: A0A0N8PVY3
AA seq 323 aa AA seqDB search
MATMETILLASFGMAIYIAFSIGANDETMAPLAGSGFVKVGTAALLGGLMAFFGAVFLGY
KVEETIGRKLLVGTVTTTDAIIIVFSIATWLTVASYRGWPISTTHSAVGAAMGLGLIKWG
IGGIAWERISGVVGAWVASPLIGLLVTMMLAKAMKRVLHAHMTGLRQRMRLSREAAFFLL
GWVSFSAFSRGANDIGNATAFISIMPGQDPLLVRLVVGVGITFGLLILGRRIIRSVGLNL
VKLSPMSALVAQISIASIMFIATLLGFPISGTHVLVGAVTGLGLAEGTWINVKALKEMLY
MWVATFVAASGISAATYVIVTSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggctaccatggaaacaatcctgttggctagtttcggaatggctatttatatcgcgttt
tccataggtgcaaatgatgaaactatggctcctttagctggaagcggcttcgttaaggtt
ggcacggccgctcttctcggcggccttatggcttttttcggtgcggttttcttagggtat
aaagttgaggaaacgataggaagaaagctcttggtaggaacggttactaccacagatgct
ataatcatagtgttttctatagcgacatggctgacggtggcatcctatcggggttggcct
atctcaactacccatagcgcggttggtgccgcaatgggactgggattaataaagtggggg
ataggtgggatagcttgggagaggataagcggagtagtgggcgcgtgggtggcatcgccg
cttattgggttgctcgtcaccatgatgttggctaaggctatgaagcgcgtcttgcatgca
cacatgactggcttgaggcagcgaatgaggctgtcacgtgaagctgctttcttcctgcta
gggtgggtctctttctcggctttttcaagaggagccaacgacatcggtaacgcaacagca
tttatcagcatcatgcctggtcaagatcccctattggttaggctcgtcgtcggtgtaggg
ataacttttggcttgctgatactcgggaggaggattataaggtctgttggattaaacctc
gtgaaactcagccctatgagcgccttggtcgctcagataagcatcgcctcgataatgttc
atcgcaaccttgctgggcttccccatatccgggacccacgtgcttgttggagccgttact
ggcttaggcttagcagagggaacgtggataaacgtcaaggctttaaaagagatgctctac
atgtgggtggcaacttttgtcgccgcatcaggcatcagcgcggctacgtacgttattgtc
acaagcctctaa

DBGET integrated database retrieval system