KEGG   Bartonella sp. JB63: BJB63x_004550Help
Entry
BJB63x_004550     CDS       T05552                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferasesubunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
barj  Bartonella sp. JB63
Pathway
barj00970  Aminoacyl-tRNA biosynthesis
barj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:barj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJB63x_004550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:barj03029]
    BJB63x_004550
Enzymes [BR:barj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BJB63x_004550
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BJB63x_004550
Mitochondrial biogenesis [BR:barj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BJB63x_004550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AQX29147
Position
518672..520171
Genome map
AA seq 499 aa AA seqDB search
MEIVDTRLPDPKRFISGVTGDWEVIIGMEVHAQVISDSKLFSGASTKFGAEPNNHVSLVD
AAMPGMLPVINQACICQAIRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFRYPIVG
EGKVVISIGPDSNGQFEDIEIGIERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVS
KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEIKNV
NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDANKGETRSMRSKEEAYDYRYFPDPD
LLPLDFDQAFVDALASELPELPDDIKARFINEMGLTAYDASILVTEKAIAAYFEEVAYGR
DGKMAANWVINDLLGALNKDNRDIEDTPITAKQLGAIIDLIKEGTISGKIAKNLFEIIWN
EGGDPHQIVEKRGMKQVTDTGVIERVVDEIIINNPDKVAQTRKKPALVGWFVGQVMKATE
GKANPQTVNKLVKIKLGID
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgttgatactcgtctccctgatcctaagcgttttatttctggagttacaggt
gattgggaggttatcattggtatggaggttcatgcgcaagttatatcggattcaaaactt
ttttcaggtgcatcaactaagtttggtgctgagccaaataatcatgtatcacttgttgat
gcagcgatgcctggtatgttgcctgttattaatcaagcatgtatttgccaggctattcga
actggtttaggattaaaagctaaaattaatttaaaatctgtttttgatcgtaaaaactat
ttttatccagatttaccgcagggatatcagatttcacaatttcggtatcccattgtaggt
gaggggaaagttgttatatctattgggccagattcgaatggtcagtttgaggatattgaa
attgggattgaaagattgcatcttgaacaagatgctggaaagtctttgcatgatcagcac
ccaacaatgtcttttgtagatcttaatcgctcaggtgttgctcttatggaaattgtttcc
aaaccagatatgcggtcttcagaggaagctaaagcctatatgacaaaattgcgtacgatt
gttcgttatttaggtacctgtgatggcaatatggatgaaggctctatgcgcgcggatgta
aatatatctgttcgccgtcctggtgggccttttggaacacgttgtgagattaaaaacgtt
aactcgattcgttttataggccaagcaattgaatatgaggcacgtcgccaaattgcaatt
ttggaagatgggggggtaatagatcaggaaactcgcctttttgatgcaaacaaaggtgaa
acacgatctatgcgttcaaaagaggaagcgtatgactatcgttattttcctgatcctgat
cttttaccattggactttgatcaagcgtttgtagacgctttggcttcagaattgcctgaa
ttgcctgatgatataaaagcgcgttttatcaatgagatgggtttgacagcgtatgatgct
tctattcttgtaacagaaaaagcaattgcagcttatttcgaagaagtagcatatgggcgc
gatgggaaaatggctgctaattgggtaattaatgaccttttaggcgctttaaataaagat
aatcgtgatattgaggatactccaattacggcaaaacaattgggagcaattattgacctt
attaaagaaggaactatttctggaaaaattgcgaagaatctgtttgaaattatttggaat
gaaggtggggatccacatcagattgtagaaaaacgtggtatgaagcaggtaacagataca
ggagttattgaaagggttgttgatgaaattattatcaataatcctgataaagttgctcaa
acacgaaagaaacctgctttggttggttggtttgttggacaggtgatgaaagcaacagaa
ggtaaggcaaaccctcaaactgttaataaattagttaagattaagcttggaatagattaa

DBGET integrated database retrieval system