KEGG   Bartonella sp. JB63: BJB63x_005870Help
Entry
BJB63x_005870     CDS       T05552                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
barj  Bartonella sp. JB63
Pathway
barj01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:barj00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BJB63x_005870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:barj01011]
    BJB63x_005870
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:barj03036]
    BJB63x_005870
Enzymes [BR:barj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BJB63x_005870
Peptidoglycan biosynthesis and degradation proteins [BR:barj01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BJB63x_005870
Chromosome and associated proteins [BR:barj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BJB63x_005870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 AMIN PGM_PMM_II GspH Imm53
Motif
Other DBs
NCBI-ProteinID: AQX29274
Position
667403..668545
Genome map
AA seq 380 aa AA seqDB search
MFQVHIQAANTLKLINLRTISDNSSTRIIAVFNAEPNFHLKILDTPTRLVINLPMVDFSM
QNKFPNNQNMLSDMLLDVHYDSSDMRASRIIFTSKTTFAIKNSRVKKLDNGLWQILIDIT
QNSQKDFNEILKNQQQIHHDITKQTNTKSHFRVVLDPGHGGSDSGARGITGILEKNITLT
FARALRDELEKDSNIHVFLTRDADEFLKLGERVKKTQDFDADLFISIHADSINIHSLRGA
TVYTLSDKASDAIAKSLADHENKVDLLDGLTAEEIPEVTDILIDLIRRETQMFSINFADR
VILNLSKNKINLINKPHRYADFLVLKASNIPSVLIEIGYLSNKEDEQLLNDPQWRKRMIV
AIADSIRQFAAEQQKIMQSL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggttcatattcaagctgctaatacattaaaacttattaatttaagaaccatt
agtgataactcatccacacgtattattgcagtttttaatgctgaacccaattttcactta
aagattttagatacacctacacgtttagttattaatttaccgatggttgatttttcaatg
cagaataaatttccaaataaccaaaatatgttatcagatatgctattggatgtgcattat
gattcttctgatatgcgagcttcgcgcattatttttacgagtaaaaccacttttgccata
aaaaatagtagagtgaaaaaattagacaatggcttatggcaaatattaattgatattact
caaaactcacagaaagattttaatgaaatattgaaaaatcaacaacaaatccatcatgat
ataacaaaacaaacaaatacaaagagtcattttcgtgttgttcttgatcctggtcatggt
ggaagtgatagtggtgcacgaggtattactggaattttagaaaaaaatataacacttact
tttgctcgtgcattacgggatgaattagaaaaagactctaatattcatgtctttttaaca
cgtgatgctgacgaatttttaaaattaggcgaaagagtcaaaaaaacacaagattttgat
gctgatctttttatctctattcatgcagatagtattaatattcattctttgcgcggagct
acagtatatactctttctgataaagcatctgatgcgattgcaaaatctttagctgatcat
gaaaacaaagtagatcttcttgatggattaacagcagaagaaataccagaagttacagat
attttaattgatcttattcgacgtgaaactcaaatgttctcgattaatttcgctgatcgt
gttattttgaacttatcaaagaataaaatcaatttaataaataaacctcatcgatatgct
gattttctagttttaaaagcttcaaatattccttctgttttgatagaaataggctattta
tctaataaagaggatgaacaattattaaatgatcctcaatggagaaaacgaatgattgtt
gctattgctgattccattcgccaatttgcagcagagcaacagaaaattatgcaatcgctt
taa

DBGET integrated database retrieval system