KEGG   Bartonella sp. JB63: BJB63x_007760Help
Entry
BJB63x_007760     CDS       T05552                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
barj  Bartonella sp. JB63
Pathway
barj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:barj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BJB63x_007760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:barj03011]
    BJB63x_007760
Ribosome [BR:barj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BJB63x_007760
  Bacteria
    BJB63x_007760
  Archaea
    BJB63x_007760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AQX29452
Position
complement(861337..861726)
Genome map
AA seq 129 aa AA seqDB search
MGKAKAPRQLKDIEAKAVARTIRVSPQKLNLVAAMIRGKKVNMALADLTFSRKRIAGTVR
STLESAIANAENNHDLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRVKRPFSHLTIIVR
EVVEKGEVA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagctaaggctccacggcaactgaaagatattgaggcgaaagctgtcgcccga
acaattcgtgtaagtccacaaaagcttaatttggttgctgcaatgattcgtggtaaaaaa
gttaatatggcattggctgatttgacattttcgcgtaagcgtattgctgggacagttaga
agtactcttgagtcagcgattgctaatgcagaaaataatcatgatcttgatattgattcc
ttgattgttgcagaagcgtatgttggtaaatctattgtaatgaagcgttttcatgttcga
gggcgtggtcgtgctagtcgagtaaaacgtccattttcccatcttactattattgttcgt
gaagttgtcgaaaaaggagaggtcgcgtaa

DBGET integrated database retrieval system