KEGG   Bartonella sp. JB63: BJB63x_011890Help
Entry
BJB63x_011890     CDS       T05552                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
barj  Bartonella sp. JB63
Pathway
barj00020  Citrate cycle (TCA cycle)
barj00640  Propanoate metabolism
barj01100  Metabolic pathways
barj01110  Biosynthesis of secondary metabolites
barj01120  Microbial metabolism in diverse environments
barj01130  Biosynthesis of antibiotics
barj01200  Carbon metabolism
Module
barj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
barj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:barj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJB63x_011890
   00640 Propanoate metabolism
    BJB63x_011890
   00660 C5-Branched dibasic acid metabolism
    BJB63x_011890
Enzymes [BR:barj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BJB63x_011890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AQX29840
Position
complement(1338724..1339920)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHEYGAPIANGVAVYSVEQAEKWVKKLPGPLYVVKSQIHAGGRGKGKFK
ELSPDSKGGVRIAKSVEEVVVNVKEMLGKTLITKQTGPEGKQVNRLYIEDGADIEQELYL
SLLVDRTVGQVAFVVSTEGGMDIEMVAEETPEKILTLPIDPMKGVTSNDCTKLCDALRLC
DNARKDGEKLFPILYKAFCEKDMSLLEINPLIVMDNGRLRALDAKVSFDNNALFRHPDIL
ELRDISEEDPKEIEASKHDLAYVALDGTIGCMVNGAGLAMATMDIIKFYGAEPANFLDVG
GGASKEKVTAAFKIITADPNVKGILVNIFGGIMRCDIIAEGVITAVKEVGLKVPLVVRLE
GTNVEQGKAIISESGLNVISAGDLDDAAQKIVAVVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaggccaaacgtttgcttcatgagtatggtgcgccaatagcg
aatggtgttgctgtttattctgtagaacaagctgaaaaatgggtgaaaaaattacctgga
ccactttatgtagttaagagtcaaattcatgctggaggccgtggaaaggggaagtttaaa
gaacttagtcctgattcaaaaggtggtgttcggattgcaaaatcagttgaagaagttgtt
gttaatgtaaaagaaatgcttggtaaaactttgataactaagcaaacaggtccagaaggt
aaacaggttaatcgcctttatattgaggatggtgctgatattgaacaggagctgtatctt
tcacttttagttgatcgtacagttggtcaagttgctttcgttgtatcgacagaggggggg
atggatattgaaatggttgctgaagagacacccgaaaaaatactcactcttcctatcgat
cctatgaaaggcgttacttctaatgattgcacgaagctttgtgatgcattaagattatgt
gataatgcacgtaaagatggcgaaaaactatttccgatactctataaggctttttgtgaa
aaagatatgagtcttcttgaaatcaatccactgattgtaatggataatggccgtttacgt
gctcttgatgcgaaagtctctttcgataataatgctttatttagacatccagatattttg
gaattacgtgacatttcagaagaagatccaaaagaaattgaagcgtcaaaacatgatctt
gcttatgtcgctcttgatgggacgattggctgtatggtgaatggtgctggtcttgctatg
gcaacaatggatatcattaaattttatggagctgagccagcgaattttcttgatgttggt
ggtggtgcttcaaaggagaaagtaactgccgcttttaaaattattacagctgacccaaat
gttaaaggcattttagttaatatttttggtgggattatgcgttgcgatattatcgctgaa
ggtgtgattactgctgttaaagaagttggtttaaaagttcctttggttgttcgccttgaa
ggtactaatgttgaacagggtaaagcaattatcagtgaaagtggtttgaacgttatttcg
gctggtgatttagatgatgctgctcaaaaaattgttgcagtagtgaagggagcttaa

DBGET integrated database retrieval system