KEGG   Bartonella sp. 1-1C: B11Cv2_001250Help
Entry
B11Cv2_001250     CDS       T05463                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00230  Purine metabolism
baro00250  Alanine, aspartate and glutamate metabolism
baro01100  Metabolic pathways
Module
baro_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:baro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B11Cv2_001250
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B11Cv2_001250
Enzymes [BR:baro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     B11Cv2_001250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ATO56911
UniProt: E6YU03
Position
117655..118944
Genome map
AA seq 429 aa AA seqDB search
MANVVVVGTQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGISYKLSLLPSGVV
RGKLSIIGNGVVIDPHHFVLELKKLRAQGIKITPEILRVAENAPLILSVHRDLDTARDSN
ISGLIIGTTKRGIGPAYEDKVGRRSIRVVDLAEADTLMPKIERLMGHHNALRRGMGVAEI
DPQTLYDELMQVADEILPFMECTWRLLDESYRIGRRILFEGAQGALLDNDFGTYPYVTSS
NTVAGQAFIGSGLSLSSIHYVLGIAKAYTTRVGGGPFPTEEMNKIGEFLGERGNEFGVVT
GRKRRCGWFDAVLVRQMVTIGGVNGLALTKLDVFDGLDEIKVCIGYELDGKKIDYLPSSM
GAQARVQPIYETLEGWKETTACVSNLTELPVQAIKYVRYIEELIGIPVILLSTSPERKDT
ILIADPFGD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtagtagttgtcggcacacaatggggagatgaaggcaagggtaaaatcgta
gattggttgtctgagcgggctgatattgtggtaagatatcaaggtgggcacaatgcaggt
catacattggttattgatgggattagttataaattatcacttttaccatctggtgtagtt
cgtggaaagctatcaattatcgggaacggtgtagttattgatccccatcattttgtttta
gaattaaaaaaattacgtgctcagggtataaagattacaccggaaattttgcgtgttgct
gaaaatgctcccttaattctttctgtgcatcgtgatcttgatacagctcgggatagtaat
atttctggtttgataattggtacaacaaaacgtggtattggccctgcttatgaagataaa
gtaggtcgccgttccatacgagtagtagatttggcagaggctgacactttaatgccaaag
attgaaaggcttatggggcatcacaacgctttacgtcgtggtatgggggttgcagaaatt
gatccacaaacactttatgatgaattgatgcaagttgcagatgaaattttaccctttatg
gagtgtacgtggcgtcttttggatgaaagttatcgtataggacggcgtattctatttgaa
ggtgcacagggtgcattattagataatgattttggaacttatccttatgtaacttcttct
aacacagttgctgggcaggcttttattggctctggtttgagtcttagttcaattcattat
gtattgggtatcgcaaaggcttatacaacgcgtgtgggaggaggaccatttccgacggaa
gaaatgaataaaattggtgaatttcttggagagcgcggaaatgagtttggtgttgtgact
ggtcggaaacgtcgatgtggttggtttgatgctgttttagtgcgtcagatggtgactatt
ggtggcgtcaatggtcttgcactgacaaagcttgatgtttttgatggtttagatgaaatt
aaagtttgtattggttatgaacttgatggtaaaaaaatagattatctgccatcctctatg
ggagcgcaagcacgtgttcagcctatttatgagacattagaaggttggaaagaaacgaca
gcgtgtgtatcaaatttgacagagctaccagtgcaagctattaaatatgtgcgctatatt
gaagaattaattggtataccagtgattttattatcaactagccctgagcgaaaagataca
atcctcattgctgatccttttggggattaa

DBGET integrated database retrieval system