KEGG   Bartonella sp. 1-1C: B11Cv2_001290Help
Entry
B11Cv2_001290     CDS       T05463                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00010  Glycolysis / Gluconeogenesis
baro00280  Valine, leucine and isoleucine degradation
baro00310  Lysine degradation
baro00330  Arginine and proline metabolism
baro00340  Histidine metabolism
baro00380  Tryptophan metabolism
baro00410  beta-Alanine metabolism
baro00561  Glycerolipid metabolism
baro00620  Pyruvate metabolism
baro00625  Chloroalkane and chloroalkene degradation
baro01100  Metabolic pathways
baro01110  Biosynthesis of secondary metabolites
baro01120  Microbial metabolism in diverse environments
baro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:baro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B11Cv2_001290
   00053 Ascorbate and aldarate metabolism
    B11Cv2_001290
   00620 Pyruvate metabolism
    B11Cv2_001290
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B11Cv2_001290
   00561 Glycerolipid metabolism
    B11Cv2_001290
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B11Cv2_001290
   00310 Lysine degradation
    B11Cv2_001290
   00330 Arginine and proline metabolism
    B11Cv2_001290
   00340 Histidine metabolism
    B11Cv2_001290
   00380 Tryptophan metabolism
    B11Cv2_001290
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B11Cv2_001290
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B11Cv2_001290
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B11Cv2_001290
Enzymes [BR:baro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     B11Cv2_001290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1542
Motif
Other DBs
NCBI-ProteinID: ATO56915
UniProt: E6YU07
Position
complement(122814..124244)
Genome map
AA seq 476 aa AA seqDB search
MLNKRQFYINGLWENPNTNNDLHVINPSTEEICAVISVGNIKDVDKAITAAKNAFQNWKT
TTPKQRLAFVEKVLEIYEKRSENIAKTISTEMGAPIDVARNSQTAAGSYHIRNFIKAFKD
FSFQKVLIKGCNHAVLQYDPIGVVGLITPWNWPMNQITLKVIPALLAGCTMVLKPSELAP
LSAMLFAEILDEASLPAGVFNLINGDGTNVGSYLSSHPDLEMISFTGSTRAGKAISKNAS
DTLKRVCLELGGKGANLIFADASGDAIQRGVNDCFHNSGQSCNAPTRMLVEHSIYNKAVT
IAQHIAAKTIVGLSSQSGNHIGPVVSKQQYDKIQALIQSGIDEGATLVAGGTGLPINMKR
GYYVRPTVFADVKPHMRIFREEIFGPVLSIIPFNTEEEAITLANNTEYGLTNYIQSKDRN
RCQRIATQLRSGMVEINGYDLPDGSYFGGIKQSGRAREGGRWGIEEFLDTKAISYW
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataagagacaattttatatcaacggtctatgggaaaatccaaatacaaacaat
gatcttcatgttattaacccatcaacagaagaaatctgtgctgttattagtgttgggaat
atcaaagacgtagataaagcaatcacagctgccaaaaatgcctttcaaaattggaaaaca
actacaccaaaacaacgtcttgcctttgttgaaaaagttttagaaatttacgaaaaacgc
tctgaaaatattgctaaaactatttcaacggaaatgggtgcacctattgatgtggcgcga
aattctcaaactgctgctggtagctaccacattcgcaattttattaaagctttcaaagac
ttttcttttcaaaaagttttaataaaaggttgtaatcatgcagttttgcaatatgaccct
attggtgttgtcggattgattacaccatggaattggcccatgaatcaaataactttaaaa
gttattcctgcattattggctggctgtactatggtcttaaaaccctctgaacttgctcct
ctttctgcaatgcttttcgctgaaattttagatgaagcttctttacctgctggtgttttt
aatttaatcaacggtgatgggaccaatgtaggctcttatttatcttcacatccagattta
gaaatgatcagtttcactggctcaacaagagcaggaaaagctatttctaaaaatgctagt
gataccttaaaacgggtctgcttagaactaggaggaaaaggggctaatcttatttttgct
gatgcttctggtgatgctattcaacgtggcgtaaacgattgttttcataatagtgggcaa
agctgcaatgcaccaacacgcatgcttgtggagcattcgatctataataaagctgtaaca
atagcacaacatattgctgcaaaaacaatagtaggactaagttctcaatcaggaaatcat
attggtcccgtagtatcaaaacaacaatacgataaaattcaagcccttattcaatctgga
atcgatgaaggagcaactcttgttgctggtgggacaggtctccctataaatatgaaaaga
ggttattatgtacggccaacagtctttgctgatgtgaaaccgcacatgcgtattttccga
gaggaaatattcggtccagttctttcaattattccctttaatacagaggaagaagctata
accttagccaataacacagaatatggtctcaccaattatatacaatcaaaagaccgaaat
agatgtcaacgtattgctacacaactacgttctggtatggtagaaattaacggatatgat
ttgcctgatggcagttattttgggggtataaaacaatctggacgcgctcgtgaaggtgga
cgttggggaattgaagaatttttagataccaaagctatttcatattggtaa

DBGET integrated database retrieval system