KEGG   Bartonella sp. 1-1C: B11Cv2_004990Help
Entry
B11Cv2_004990     CDS       T05463                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00860  Porphyrin and chlorophyll metabolism
baro00970  Aminoacyl-tRNA biosynthesis
baro01100  Metabolic pathways
baro01110  Biosynthesis of secondary metabolites
baro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B11Cv2_004990
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B11Cv2_004990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:baro01007]
    B11Cv2_004990
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:baro03016]
    B11Cv2_004990
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:baro02048]
    B11Cv2_004990
Enzymes [BR:baro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     B11Cv2_004990
Amino acid related enzymes [BR:baro01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   B11Cv2_004990
Transfer RNA biogenesis [BR:baro03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B11Cv2_004990
 Prokaryotic Type
   Other AARSs
    B11Cv2_004990
Prokaryotic defense system [BR:baro02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    B11Cv2_004990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ATO57274
UniProt: E6YVV6
Position
546379..547767
Genome map
AA seq 462 aa AA seqDB search
MIKVRFAPSPTGYIHIGNTRIALFNWLYAKAHNGTFILRYDDTDAKRSKQEYIDALMVDL
EWLSIQPDEVYYQSKRFNRYDEVAEVLKQRGLLYPCYETAEELDRRRKIQLSRKLPPVYN
RDALKLTLEDKKAFEDQGRKPHWRFLLPNFESNPFQTKRTEVYWDDIVKGRQTIDLASMS
DPVLIREDGSYLYTLPSVVDDIDMAITHIIRGGDHIANTAAQIALFKALDAVSPIFGHIN
LLTTTSGEGLSKRNSDLSVRSLREDGFESMAVQCLAVLIGTSQNVQAYPNQDILLKHFYL
EDTSKSAAKFDVTDLLILNSHFVHELTYEDIKTRLEKFSIHGEQAEYFWNTVKNNITKLN
DTVLWWKIIHTDESFDVTSPEDRVYVQQSVHLLPEGGLNDESWKIWTTALQEKTGRKGKA
LFMPLRQALTGITHGPEMGKILLLLGREKIIKRLTMVGSGKL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagttcgttttgccccatctccaacaggttatattcatataggaaatactcgt
attgcattgtttaattggctgtatgcgaaagcgcataacggtacatttattttacgttat
gatgatacagatgctaagcggtccaaacaagaatatattgacgctcttatggttgatctc
gaatggcttagtattcaaccagatgaagtttattatcagtctaaacgctttaatcgatat
gatgaagttgcagaagttttaaaacaacgtggccttctttatccttgttatgaaacagcg
gaggaattggatcgacgtcgtaaaatacaactttcacgtaaattaccccctgtttataat
cgtgatgcattaaaattgacattagaagataaaaaagcttttgaggatcaaggtcgtaaa
cctcattggcggtttcttttgcctaattttgaaagtaatccatttcaaactaaacgaaca
gaagtttattgggatgatatcgtaaaaggtaggcagacgatagatttggcttctatgtca
gatcctgtcttaattcgtgaagatgggagctatctttacactctaccttctgtcgttgat
gatatagatatggctattacacatattattcgtggcggtgatcacattgctaatactgct
gcgcagattgctctctttaaggctctcgatgcagtgtctccaatttttggtcatattaat
ttattaacaacaacttcaggagaggggctttcaaaacggaatagtgatctttccgttcgt
tctttgcgcgaagatggctttgagtctatggctgttcagtgtcttgcagtgttaattggg
acgtcgcaaaatgtacaagcatatcctaatcaagatattcttttaaagcatttttatctc
gaggatacatcaaaatcagcagcaaaatttgatgtaactgatcttcttatattgaatagt
cattttgttcacgaattgacttatgaagacatcaaaacacgacttgaaaaattttctatt
catggagaacaagcagaatatttttggaatacggtaaaaaacaatattactaagctgaat
gatacagttttatggtggaaaattattcacaccgatgagagctttgatgtaacctctcct
gaagatcgtgtttatgtgcaacagtctgttcatttattacctgaggggggattgaatgat
gaaagttggaaaatttggacgacggcgttacaagaaaaaacgggtcgtaaaggaaaagct
ttgtttatgccgttgcgtcaagctcttacggggataacgcatggacctgaaatgggaaaa
attttactacttttagggcgtgaaaagataataaaaagattaactatggtaggtagcgga
aaactctaa

DBGET integrated database retrieval system