KEGG   Bartonella sp. 1-1C: B11Cv2_005590Help
Entry
B11Cv2_005590     CDS       T05463                                 

Definition
(GenBank) RNAse R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:baro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    B11Cv2_005590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:baro03019]
    B11Cv2_005590
   03016 Transfer RNA biogenesis [BR:baro03016]
    B11Cv2_005590
Enzymes [BR:baro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     B11Cv2_005590
Messenger RNA biogenesis [BR:baro03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     B11Cv2_005590
Transfer RNA biogenesis [BR:baro03016]
 Prokaryotic Type
  tRNA degradation factors
   B11Cv2_005590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB S1 CSD2 DUF2794 Zincin_1
Motif
Other DBs
NCBI-ProteinID: ATO57329
UniProt: E6YVP6
Position
complement(611919..614207)
Genome map
AA seq 762 aa AA seqDB search
MAKSEKKTKYFQISNTKKLPSKSEILSFITHNPNQSSKRKVAKAFNLNSASHIWLKDILR
NLKDNYAIPKKRKNLSIKKGLPSITLVKVSALDKDGDFIAEPLEWPNDPKPNIQISSSHR
IRGASISIGDHVLVKIFRNKVLQNFPYRGRIIRKIDKKKRNMLGIVRELENGEWQIDPIE
RKNNELIIDMSTSIDIKAGDLVEIEINNSTNYSFKKAKVRNILGHINNENNETDFSMIAL
ISKEIPHIFPSDVLEQAENVKPDNSINREDWRQLPFITIDPPDAKDHDDAVYAIKDKSPT
NNGGWIIIVAIADVSCYIQAGSILDQEALKRGNSVYFPDRVVPMLPECISNDRCSLHEGK
DRPALAVRMIFDANGNKRKHSFHRIVMRTVAKLSYQEVQCAIEGKTNQKTAPLLENILQP
LWGAYSCLKIARNRRQPLELEVPDKKIILNQNGHIQDVVILSHLEAHRLIEEFMIQANVA
AAETLKGHHQPLIYRIHSKPSLAKQEMLQNFLQSLGISLARGAELTSAQLNNILTKAINT
EQEELVNQIILRSQSQAEYSPENIGHFGLNLPNYTHFTSPIRRYADLIIHRALIKALKLG
NDGLTDEQEKNFAKIATQISLYERRAMTAERETIDRLVAHYLVNKIGHSFTAHISGVTKA
GLFIALDKLNADGFVPISTLKSDYYYFDEVQHTLIGKRSHKCYQLGDVVEVKILEVQPFS
GALCFEMLTKPRLITSLPISYHKNKSIVKKRNYVSNKKDNLE
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaagcgagaaaaaaacaaaatattttcaaatctctaatactaagaagctacct
agtaaatcagaaattttatcctttatcactcataatccaaaccaatcgagtaaacgaaaa
gttgctaaagcttttaacttgaatagtgcttctcatatatggttaaaagatatattgcgt
aacttaaaagataactatgcaataccaaaaaaacgtaaaaatttaagcatcaaaaaggga
ttaccatcgattactttagtcaaagttagcgctcttgataaagacggtgactttattgca
gaacctcttgaatggcccaatgatccaaagcccaatattcaaatttcttcttctcatcgc
ataagaggagcaagcattagtattggagatcacgtcctagtaaaaatttttcgaaataaa
gttttgcaaaattttccttatagaggacgaatcatccgcaagattgataagaaaaaaaga
aatatgcttggtatagtgagagaattagaaaatggcgaatggcaaatagatcccatagaa
cgtaaaaacaacgagcttattattgatatgtctacgagcatagatatcaaagctggtgat
cttgtcgaaattgaaattaacaacagtactaactacagcttcaaaaaagcaaaagtaaga
aatattttagggcacattaataatgaaaataatgaaacagatttttcaatgattgccctt
atatcaaaagaaattcctcatatttttccctcagatgtccttgaacaagctgaaaatgta
aaacctgataactctattaaccgcgaagattggcgacaattaccgtttattacaattgac
cccccagatgcaaaagaccatgatgatgcagtttatgcaataaaggacaaaagccctacc
aataacggaggttggattatcattgtcgcaattgcggatgtttcttgctatatacaagca
ggaagtattctagatcaagaggcattaaaacgaggaaactctgtttattttcctgatcgt
gtcgtaccaatgcttccagaatgtatttctaatgatcgctgttcattgcatgaaggaaaa
gatagacctgcactagctgttcgtatgatttttgatgcgaatggaaacaaacgtaaacat
agtttccatcgtattgtaatgcgtacagtagccaaattatcctaccaagaggtacaatgt
gcaattgaaggaaagacaaatcaaaaaacagctcccttacttgaaaacattttacaacca
ttatggggtgcttattcctgccttaaaattgcgcgcaatcgccgacaaccattagaatta
gaagtaccagacaaaaagattattcttaatcaaaatggacacattcaagatgttgtgatt
ttatctcacctagaagcacatcgattaattgaagagttcatgatacaagcaaatgttgca
gctgctgaaacattaaaaggacatcatcaacctctcatttatcgtattcatagtaagcca
tctcttgcaaaacaagaaatgctccagaactttcttcaaagtctaggaatttcactcgca
cgaggagctgaacttacatcagcacagcttaataatattcttacaaaagctataaatacg
gaacaagaggagttagtaaatcagattattttgcgctcacaatctcaagccgaatatagt
cctgaaaatataggccactttggtttaaatctgcctaactatacacattttacctcacca
attcgccgttatgctgatttaattattcatcgagcgcttataaaagctctgaaattgggt
aatgatggactcacagatgaacaagagaaaaattttgcaaaaattgctactcaaatttct
ttatacgaacgccgcgcaatgacggcagaacgagaaactattgatcgacttgttgcacat
tacttagttaataaaattggacactcatttacagcccatatttcaggagttacaaaagca
ggtctttttattgcacttgataaattgaatgcagatggttttgtacctatttctacactt
aaaagtgattattactattttgacgaagtacagcatacccttataggaaaacgcagccat
aaatgttatcaactcggtgatgtagtcgaagtaaaaattttagaagtccaacctttttct
ggtgcgttatgttttgaaatgttaacaaaacctcgtctcataacttctttacctatctcc
taccacaaaaataaatctatagtgaaaaaacgcaattatgtttctaataaaaaagataac
cttgaataa

DBGET integrated database retrieval system