KEGG   Bartonella sp. JB15: BJB15x_011170Help
Entry
BJB15x_011170     CDS       T05113                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bart  Bartonella sp. JB15
Pathway
bart00900  Terpenoid backbone biosynthesis
bart01100  Metabolic pathways
bart01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bart00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJB15x_011170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bart01006]
    BJB15x_011170
Enzymes [BR:bart01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BJB15x_011170
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BJB15x_011170
Prenyltransferases [BR:bart01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BJB15x_011170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AQX28489
UniProt: A0A1S6XIR7
Position
1231977..1232879
Genome map
AA seq 300 aa AA seqDB search
MHEFKILLAKYAHNIEKRLDTLLSHKAQNGEIIRPKILIDAMRHGVLNGGKRLRPFLVIQ
SATLFDVPPEQSLDIGVALECLHCYSLIHDDLPALDNDTLRRGKPTVHVAFNEATAILAG
NALLTFAFEIIANKACSFSPKTKINLITALTQATGLGGMIGGQMLDLEAEKKPQDESAII
TLQHMKTASLMRFACQAGAIMGQASKTLTDKLASFGTQIGLAFQLTDDLLDLISQTKILG
KTVGKDQTANKATLVNLYGIDEVQKKRDELIKKAEELLIPFGAKAIPLKQAAHFIAKRKN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaatttaagattcttcttgcaaaatatgcacacaatattgaaaaacgactcgat
acacttctaagtcataaagcccaaaatggtgaaattatccgacctaaaatccttatcgat
gccatgcgtcacggtgttttaaacggtggtaaacgcctacgccctttcttggttattcaa
agtgctactctttttgatgtccctcctgaacaatctcttgatatcggcgtggcattggaa
tgtcttcactgttattcactcattcacgatgatcttcctgctctagataatgatacactc
cgacgcggcaaacccactgttcacgtagcctttaatgaagcaacagcaattttagcaggt
aatgctcttctcactttcgcttttgaaatcattgctaataaagcctgttctttttctcca
aaaacgaaaattaatctgatcacagctctcacacaagctacgggtcttggtggtatgatt
ggtggacaaatgctcgatctagaagctgaaaaaaaaccacaagatgagagtgcaataatc
actctacaacatatgaaaacagcctctcttatgcgttttgcttgtcaagcaggtgcaatt
atggggcaagcttccaaaacattgaccgataaacttgcctcatttggaacacagattggc
ttggcttttcaattgaccgatgaccttcttgatctaatttctcaaacaaaaattcttgga
aaaactgtagggaaagaccaaacagccaacaaagcaacactggttaatctttatggtatt
gatgaagtccaaaaaaaacgagatgaacttattaaaaaagcggaagaacttctcatcccc
tttggagctaaagccatcccactcaaacaagcagcacattttattgcaaaacgcaaaaat
taa

DBGET integrated database retrieval system